KEGG   Drosophila erecta: 6548790
Entry
6548790           CDS       T01060                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
der  Drosophila erecta
Pathway
der00230  Purine metabolism
der01100  Metabolic pathways
der04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6548790
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    6548790
Enzymes [BR:der01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     6548790
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 6548790
NCBI-ProteinID: XP_001973978
FlyBase: FBgn0113520
UniProt: B3NLR2
LinkDB
Position
Unknown
AA seq 1167 aa
MEANLEKGQMTTASTSKSPSQRQTTSRRRQNDSDVAGGVGITGGGVVILPQHVLNELYHN
YSIKQRRSGLKWFVFAAVLFNFWTIGIPWDQAAPTRVVNCCMLVAYLALTALLYIGRRSD
RPALRRLHQILLIIVPRALWLLSIVHFTVYIILQPSFSPRDLLGWAILLNFLVYVTLPLQ
LIFLGLSIGCITYFICLSLPVGYSHWDSLLSNQLAANAVLIATAALIGLLYYFMGEAKQK
RAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRHE
NVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGA
PDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQWQFDVYS
KDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAGLKTYFITKVV
KAFSSPCAKKINESQDEISPSSPNGSMNDIVSEEDDNDATLDDEELLAQNSLSNGHQIVT
TVTADEEEQVKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNPQLEQSYAVYREPYSS
LPLLAALMVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVVISLAESFGGMLPKFFVD
VSKRFNDITFVRELAAIIIALTIGFSNVIDMFFFVTFVRTEHIVSESEFNVTASLDSDIA
VEMEAIVTAEHLLPASFVEQMREAVPPERVLYPSYLSNFGVLILIAIAVIAQLTHLTKIL
LLLSIAALHCYFNIFIMQDLYALEDDFEHQPIISTRYAASGLLLVAALALSTLARHMDHE
DRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEV
GVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYM
AASGINQQRTLRNDAPITERWSHLAILVEFALELKHALHGINEQSFNHFVLKMGINHGPI
TAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEDTCNILQPFGYKFLQRGLVAVK
GKGQLMTFYLQGKSQPSAEPVPPGVVDLNGLDSSALESTSELEASDIKMPLLKMNVQEQS
VGIDQDQSLRNESEGQEGVGEFQSLLE
NT seq 3504 nt   +upstreamnt  +downstreamnt
atggaagcaaatttggagaaaggtcagatgacgaccgcatcgacaagcaaatcgccctcg
cagcgtcagacaacatcccgtcggcggcaaaacgacagtgatgtggccggaggagtggga
atcaccggtggtggagtcgtcattctgccacagcacgtgcttaacgaactctaccacaac
tactccatcaaacaacgccgcagtggattgaagtggtttgtcttcgcggccgtattgttc
aacttttggaccatcggaataccatgggatcaggcggcccctacgagagtggtcaactgt
tgtatgctggtggcgtacttggcattaacagcgctcctttacattggacgacgttctgat
cgaccggcactgaggcgcttgcaccaaatactcttgattattgtaccacgggcactgtgg
ctattaagcattgtacattttaccgtctatattattctgcaacctagtttttcaccaagg
gaccttcttggctgggccatccttctaaatttcttggtctatgtgacgctgccattacag
ctcattttccttggtctgtcgattggatgtatcacatattttatttgtcttagtctgcct
gttggctattctcactgggactcgctactctcgaaccagttagcggctaacgctgtttta
atagccacggcagcgctcattggccttttgtactactttatgggtgaggcgaaacagaaa
cgagccttcctcgaagccaaaaagagcctcgaagtaaaaatggtcatagaggaacagtcg
gccgagcaggagcgtctgcttttgtctgtgctgcccaagcacgtggctattaagatgcgg
gaagatttgggatcatccagttccgaggcttttaaaaaaatctacatgagtcggcacgag
aatgtaagcatactatatgcggatattgttggctttaccgctatctcctccacgtatagt
gcccaagatttggtaaaaatgcttaacgagctctttgcgcgtttcgataggcttgccgag
aaatatcaacaattgcgcattaagattcttggtgattgctattattgcattagcggtgcc
cctgatgagcgtccagatcacgccgtcatgtgcgtgcacatgggactctccatggtaaag
gccattaagtatgtgcagcagaaggccaactcacctgttgatatgcgagtgggcattcac
actggagccgtgctcgccggcattctcgggcagcggcagtggcaatttgacgtttactca
aaggacgtagaactggctaataaaatggaatcgagcggaaaagctggacgcgttcacatt
tcggacaaaacgcttgcatttctgaacggcgaattcgaagtggagcccgcctttggggag
aaacgggaggagctgttgcgtattgctggactaaagacgtattttattaccaaagtagtt
aaggcgttttcatcgccatgtgccaaaaaaataaatgaatcccaggatgaaatctcaccc
tccagtcctaatggatcgatgaacgatattgtttcagaagaagatgacaacgatgccaca
ttagacgacgaagagctcctggcgcagaattctttatccaatggacaccaaatagtgact
acagtgactgcagacgaagaggagcaggtgaaattggagaacttcaaacaacgattgaaa
gatgaactggtaacgcgcgacggacatgaaaacctaaccaaggacactaacatattcttg
cgcttcaaaaacccgcagctggagcaatcgtacgccgtatatagagagccgtacagttca
cttccgcttcttgccgctctaatggtgcagtgcattgatgtgttatactcatacttagtc
ctgccgagatctaccctgcatttcattaacatagctgcgccgttggtaccgatcgccatg
ctggtagtgatcagccttgccgagagctttggcggcatgctgcccaagtttttcgtagat
gtgagcaagcgcttcaatgacataacctttgttcgcgagctggctgccataattattgca
ctcaccattggcttcagtaacgttatcgacatgttctttttcgtcaccttcgtgcgtacc
gagcatattgtgagtgaaagcgagttcaatgtaacggcgagcctagatagcgatatagcc
gtggagatggaggcgattgttaccgcagaacacctacttccggcatcatttgtggaacaa
atgcgcgaggctgtgcccccggaacgagttctatatccgtcctacttaagtaactttgga
gtacttatattaattgcgatcgccgtgattgcccaacttactcatcttacgaagattttg
ctgctattgtccattgcagctttgcattgctatttcaatatattcatcatgcaggatctt
tatgctctagaggatgattttgaacatcaacctattatatctacgcgatatgctgcttca
ggacttctgctagtggctgctctggcgctaagcaccttggcaagacacatggaccatgaa
gatagggtcattttcaaatggaaaactgaggtggccgagcaaaaggagaccgcaaacgat
atgcggcagcgaaatgaggctttggtctacaatgtcttacctgtccatgtggcagagcac
ttcatgaagaacactaaacgctctcatgatgatctttattctcagagctatgctgaagtt
ggggtattattcgccagcatgccaaacttttctgatttctattccgaagaaactgtaaac
aaccagggtttggagtgtttacgatttctcaatgaggttatctcagattttgatgctttg
ttggagctgccccaattccaagacatcatcaagataaaaactattggttccacatatatg
gctgccagtgggataaatcagcagagaactcttagaaatgacgcccccattacagaaagg
tggtctcacctagccattttggtggagtttgcattggaactgaaacacgccttgcatggc
atcaacgagcagtcgttcaatcacttcgttctcaagatggggatcaatcatggaccgatc
acggctggcgttattggcgcacgtaagccgcattacgacatctggggtaatacggtgaat
gtggcatcgcgaatggagagcacaggaaaggcaggcgccattcaggtcacagaggatacc
tgcaatattttacaaccgtttggttacaaattccttcagcgtggtctggtagctgtcaaa
ggaaagggacagttgatgacattttatctgcagggtaagtcccagccgagtgctgagccg
gtaccccccggcgtagtcgatctcaatgggctggattcgtctgccctagaatccacaagc
gaactggaggcctcagacattaagatgcccctgctgaagatgaatgtccaagagcaatcg
gtgggaatcgaccaagatcagagcttgagaaatgaaagtgagggccaagagggggtggga
gaatttcagtctttgctagaataa

DBGET integrated database retrieval system