KEGG   Drosophila erecta: 6549100
Entry
6549100           CDS       T01060                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase 1 isoform X2
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00030  Pentose phosphate pathway
der00051  Fructose and mannose metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6549100
   00030 Pentose phosphate pathway
    6549100
   00051 Fructose and mannose metabolism
    6549100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6549100
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     6549100
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6549100
SSDB
Motif
Pfam: FBPase FBPase_C Inositol_P
Other DBs
NCBI-GeneID: 6549100
NCBI-ProteinID: XP_015012041
UniProt: A0A0Q5VXL5
LinkDB
Position
Unknown
AA seq 334 aa
MSQQGPAFDSNAMTLTRFVLQEQRKFKSATGDLSQLLNSIQTAIKATASAVRKAGIAQLH
GFAGDVNVQGEEVKKLDVLSNELFINMLKSSYTTCLMVSEENENVIEVEVEKQGKYIVCF
DPLDGSSNIDCLVSIGSIFAIYRKKSDGPPTVEDALQPGNQVVAAGYALYGSATAIVLGL
GSGVNGFTYDPAIGEFILTDPNMRVPEKGKIYSINEGYAGDWENGVFNYIAAKKDPAKGK
PYGARYVGSMVADVHRTIKYGGIFIYPATKSAPSGKLRLLYECVPMAYLMIQAGGLASDG
KISILDIVPKKIHERSPIFLGSKADVEEALSYLK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagtcaacaggggccagcttttgactccaatgcgatgacgctgacgcgattcgtgctg
caggagcagcgaaagttcaagagtgccactggcgatctctctcagctgctcaactccatc
caaactgccattaaggctacagcatccgcggtccggaaggccggtatcgcccagctccat
ggattcgctggcgacgtgaatgtgcagggcgaggaagtgaaaaagctcgacgtgctctcc
aacgagctgttcatcaacatgctgaaatcatcctataccacatgtctcatggtttccgaa
gagaacgagaacgtgatcgaggtggaagtggagaaacagggcaaatacatcgtgtgcttc
gatcccctggatggatcctccaacatagactgtctggtgtcgatcggttcgatctttgcc
atttaccgcaagaaaagcgatggtccgcccacagtggaggatgccctgcagcctggtaat
caggtggtcgccgccggatacgcactgtacggctcggccacagcaatagtcctaggtcta
ggttccggagtgaatggcttcacttacgacccggccatcggagagttcatactgaccgat
cccaacatgcgggtgccggagaaggggaagatttactcgatcaacgagggttatgcaggg
gattgggagaatggtgtgttcaactacattgcggccaagaaggaccccgccaagggaaag
ccctatggagcgaggtacgtaggatccatggtcgcagatgtgcatcgtaccatcaaatac
ggtggcatcttcatctatccggctacaaaatccgctcccagcggaaaactccgtctgctg
tacgagtgcgtacctatggcctatctgatgattcaggctggaggcctggccagcgatgga
aagatcagcattttggacattgtgcccaagaagattcacgaacgcagtcccatattccta
ggatccaaggccgacgtggaggaggcgctcagctacttaaagtga

DBGET integrated database retrieval system