KEGG   Drosophila erecta: 6550234
Entry
6550234           CDS       T01060                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
der  Drosophila erecta
Pathway
der04013  MAPK signaling pathway - fly
der04214  Apoptosis - fly
der04215  Apoptosis - multiple species
der04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:der00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6550234
   04391 Hippo signaling pathway - fly
    6550234
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6550234
   04215 Apoptosis - multiple species
    6550234
SSDB
Motif
Pfam: TNFR_c6 Comm PhoR
Other DBs
NCBI-GeneID: 6550234
NCBI-ProteinID: XP_001977685
FlyBase: FBgn0110324
UniProt: B3NTG1
LinkDB
Position
Unknown
AA seq 347 aa
MMPPRLPGGHGGAMGSRSSSSGHHLSTTFHKRRRRRQQHHISISISISHGSYLALLLLST
TCSLVASSASASSASSAADTGIAPPDPPPASQVSISSSSPCAPQHWWDSQRDRCTPCTRC
QGEMIPLRPCQLHTDTICGSIYDLKIDWVVLAKTEPNWKERRKSSEYEHFEHNVPLQHLT
HEQLQQLHEEAAAGWVLDWQTGVLYVAVLTCLVFFSVAACILIHHMRQWRRMERRLDQDV
EELSTKLMAKLAEVQSLDGGTFFIGNADALRGLPASAATTHPATAQSGIFQPQHVLLPEK
RGKHQERRILKTLQPGNVYIEESNAGLGGMGGMGVGLGVRNCSGLKG
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgatgccgccaagactgccaggcggccatggaggagccatgggtagtcggagcagcagc
agtggccatcacttaagcacaacgtttcacaagcgccgacggaggcgacagcagcaccac
atcagcatcagcatcagcatcagccacggcagctacctggccctgctgctgctgtccacc
acctgctccctggtggccagcagcgcctccgcttcatccgcatcctccgctgcagacaca
ggcattgcgccaccagatccgccgccggccagccaggtgtccatctcctccagctcgccc
tgcgccccacagcattggtgggactcccagcgggatcgctgcacaccgtgcacccgctgc
cagggcgagatgataccgctccggccctgccagctgcacacggacaccatctgcggctcc
atatacgacctcaagatcgactgggtcgttctggccaagaccgagcccaactggaaggag
cgccgaaagtcctcggagtatgagcacttcgagcacaatgtcccactgcagcacctgacc
cacgagcaactgcagcagctgcacgaggaggcggccgccggctgggtcctcgactggcag
actggcgtcctctacgtggccgtgctcacctgcctggtcttcttctcggtggccgcctgc
atcctcatccaccacatgcgccagtggcgtcgcatggagcgtcgcctggaccaggatgtg
gaggagctgtcgaccaagctgatggccaagctggcggaggtgcagagcctggacggaggc
accttcttcatcggcaacgcggacgccttgcgaggactgcccgcctccgcagcgacaacg
catccagccacggcgcagtcggggatcttccagccacaacacgtgctgctgcctgagaaa
cgcggcaagcaccaggagcgacgcatcctgaagaccctgcagcccggcaatgtctacatc
gaggagagcaacgcgggactgggcggcatgggcggcatgggcgtgggcctgggcgttcgg
aactgctccgggctgaagggctga

DBGET integrated database retrieval system