KEGG   Drosophila erecta: 6550630
Entry
6550630           CDS       T01060                                 

Definition
(RefSeq) glucose dehydrogenase [FAD, quinone]
  KO
K00115  glucose 1-dehydrogenase (FAD, quinone) [EC:1.1.5.9]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6550630
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.9  glucose 1-dehydrogenase (FAD, quinone)
     6550630
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Lycopene_cycl DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 Thi4 HI0933_like
Other DBs
NCBI-GeneID: 6550630
NCBI-ProteinID: XP_001978142
FlyBase: FBgn0111634
UniProt: B3NUX1
LinkDB
Position
Unknown
AA seq 633 aa
MSAINTFVAMWRFLLTLGPSAMIILLLNKGILEQRPDIVDEQHRVRSIQIEDLRESYDFI
VIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLTEPSD
RYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAELGNPGWNYANVLHYFRK
LEDMRVPGFEHSPYHGHGGPISVERYRFPSALLDIFMRAAQQLGLVHPDGDFNGRTQTGF
APPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERILIDPQSHRAIGVIFEYGLLK
HTVRAKREVILSAGSLASPQLLMVSGVGPSDQLEPLGIPVVQHLPGVGGNLQDHISTSGA
IYTFDSGQNHHLSFVVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFSTRYQDPRLDWP
DVQIFMGSYGYGADGGMIGRRGAAITLDNYAEAFEPMIYQDSFVIAPLVMRPRSRGFLQI
RSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVMQSLNATMNIYEWRNCPEVE
YLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRLRVRGMRGLRVIDASIMPTI
PTGNTNAPTLMLAERGADIIKEDWRHYRDGGWG
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgtcggcgatcaacacgtttgtggccatgtggcggttcttgctgaccctcggcccctcg
gccatgatcatcctgctcctgaacaagggcatcctggagcagcggccggatattgtggat
gaacagcatcgcgtacgctccatacaaatcgaagatcttcgcgaatcctacgatttcata
gtcattggcggcggttcggcgggctgtgttttagccgccagactctcggagaatccggaa
tggagtgtactacttttggaagctggaggggatgagccactgctcatcgatttgccgcaa
ttgtatccggtattccagcgaagcccgtgggactggaagtacctcaccgagccatcggat
cgatactgcttggccatggaggatcaacgctgcttttggccacgggccaaagttttgggc
ggatgcagttccatcaatgccatgatgtacatacgcggaaatagacgggactacgatcaa
tgggcggaactgggcaatcctggctggaattacgccaatgttctgcactatttccgcaag
ctggaggacatgagggtgcctggattcgagcatagtccgtaccatggccatggtggtccc
atttccgttgaaagatatagatttccctcagcgcttttggacattttcatgagggctgcc
cagcagctgggcttggttcatcccgatggcgatttcaatggtcgaactcagacagggttc
gctccaccacatggaagccttcgcgatggactgcgttgcagtgccaataagggatatatt
cgccggagttggcagcgtcccaatttggatatcgttctcaaggcctttgtggagcgaatt
ttgatcgatccgcaatcccatcgagcaatcggagtgatcttcgagtacggtctgctgaag
cacacggtcagagccaaacgggaggtgattctgtccgctggatccctggccagtccgcaa
ctcctgatggtcagtggtgtgggcccgagcgatcaactggaaccactgggcattccggtg
gtgcagcatttacccggtgtgggtggcaatctgcaggatcacatctccacctcgggcgcc
atctacacattcgacagtggccaaaatcatcatctgtcgttcgttgtgcccgaaatgatg
aacgaacaggcggtggaggattttgttcaaggatcagatagcttcttctacgcgatgccc
gtgagtgaggtgatgggcttcttcagcactcgctatcaggatccccgattggattggcca
gatgtccaaatctttatgggcagctatggctacggagccgatggtggaatgattggtcgc
agaggagctgccattacactggacaactatgccgaggcgtttgagccgatgatctaccag
gattcgtttgtgatagctccactggtgatgcgcccacgctcccggggattcctacagata
cgctctgccgaccccaaagtccatcccctaatccatgccaactactacgacgatccgcac
gacatggccgtcatggtggagggcctgaagttggcccatcgtctaacacaaacgccggtg
atgcagtccctgaatgccactatgaatatctacgagtggcgcaattgcccggaggttgag
tatctcagcgatgcgttctgggagtgcttggccagattctactcgcagacgatctaccat
ccggtgggcacctgtaagatggctccagcctcggatcccgccggtgtcgtagatccccga
ttgcgggtcagaggaatgcggggattgcgggtcatcgatgccagcataatgcccactatt
ccgactggcaatacgaatgctccgactttaatgctggcggagaggggagcggatatcatc
aaggaggactggcgtcactacagagatggaggttggggctag

KEGG   Drosophila erecta: 6552663
Entry
6552663           CDS       T01060                                 

Definition
(RefSeq) glucose dehydrogenase [FAD, quinone]
  KO
K00115  glucose 1-dehydrogenase (FAD, quinone) [EC:1.1.5.9]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6552663
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.9  glucose 1-dehydrogenase (FAD, quinone)
     6552663
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Pyr_redox_2 DAO Lycopene_cycl FAD_binding_2 NAD_binding_8 Thi4 TrkA_N Trp_halogenase HI0933_like
Other DBs
NCBI-GeneID: 6552663
NCBI-ProteinID: XP_001979171
FlyBase: FBgn0013802
UniProt: B3P2V7
LinkDB
Position
Unknown
AA seq 612 aa
MSASSSACDCLVGVPTGPTLASTCGGSAFMLFMGLLEVFIRSQCDLEDPCGRASSRFRSE
PDYEYDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLNFIGSDIDY
RYNTEPERMACLSSAEQRCYWPRGKVLGGTSVMNGMMYIRGNREDYDNWAAQGNPGWAYN
DVLPFFKKSEDNQELDEVGTEYHAKGGLLPVGKFPYNPPLSYAILKASEELGFSVQDLNG
QNSTGFMIAQMTARNGIRYSSARAFLRPARMRNNLHILLNTTATKILIHPHTKNVLGVEV
SDQFGSMRKILVKKEVVLSAGAVNSPQILLLSGVGPKDELQQVNVRTVHNLPGVGKNLHN
HVAYFTNFFIDDADTAPLNWATAMEYLLFRDGLMSGTGISDVTGKLATRWAERPDLPDLQ
FFFGGYLASCARTGQVGELLSNNSRSIQIFPAVLNPRSRGFIGLRSADPLEPPRIVANYL
TDERDVKTLVEGIKFAIRLSQTTPMKQYGMRLDKTVAKGCESNAFGSDAYWECAVRQNTG
PENHQAGSCKMGPSHDPMAVVNHELRVHGIRGLRVMDTSIMPQVTAGNTHAPAVMIAEKG
AYLLKRAWGAKV
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgtccgccagctcctcagcctgcgattgtttggtgggcgtgcccactgggcccaccctg
gcctccacatgtggtggtagtgcctttatgctgttcatgggcctcctggaggtcttcatc
cgctcccagtgcgatctggaggatccctgcggaagggccagctctcggtttcgatcggag
ccggactacgagtacgatttcattgtcattggcggcggctcagcgggctctgtggtggcc
tctcgactgtccgaggtgccccaatggaaggtgcttttgatcgaagccggtggcgatgag
cctgtgggagcccagattccctcaatgttcctcaactttattggcagcgacatcgactac
cgctacaacacggaaccggagcgaatggcctgtctgtcctcggcggagcagcgctgttac
tggccgcgtggcaaggttctgggcggaacctcggtaatgaacggaatgatgtatatacgc
ggcaaccgggaggactatgataattgggcagcgcaagggaatcctggttgggcctacaac
gacgtgctcccgttcttcaagaagtcagaagacaaccaggaactggatgaagtgggcact
gaatatcacgccaagggtgggctgttgccagtgggcaagtttccatacaacccaccgcta
tcctacgccattctgaaggccagcgaggaattgggcttctccgtgcaggatctgaatggt
cagaactccaccggatttatgattgcccagatgacggcccgaaacggaatcagatatagc
tcagctagggccttcctgcgaccggctcgcatgcgcaacaatctgcatatcctgcttaac
accacggccaccaagatccttattcatccgcacactaagaatgttctgggagtggaagtc
agtgaccaattcggcagcatgcgtaaaatcctggtaaagaaggaggtggttttgagtgct
ggcgctgtcaactcgcctcagatcctgctactgagtggagtgggtcccaaggacgaactg
cagcaggtgaatgtgaggaccgtgcacaacctaccaggcgtgggaaagaatctgcacaat
cacgtggcctattttaccaacttcttcattgacgatgcggacacggcgccacttaactgg
gccacggctatggagtacttgctgttccgggatggtctcatgtccggcactggcatttcg
gatgtgaccggaaaactggccactcgatgggccgaaaggcctgaccttcccgatctccag
ttctttttcggcggctacctggccagttgtgcccgcacaggacaggtgggcgagttgctc
tcgaataactctcggtccatccagatcttcccagcagttttgaacccccgatcgcgaggc
tttataggcctgcgatccgctgatcccctagagccgccgcgtattgtggccaactactta
acagacgagcgggatgtgaagacactggtggagggcattaagtttgccatccgattgtcg
caaacgacgccaatgaagcagtacggaatgcggctggacaagacagtggccaagggatgc
gaaagcaatgccttcggcagcgatgcctactgggagtgcgccgtgaggcagaatacgggt
ccggagaatcaccaggctggctcctgcaagatgggtcccagccacgatcccatggcggtg
gtcaaccacgagttgcgagtccacggcattcgaggactccgagtcatggacaccagcata
atgccgcaggtcaccgcgggaaacacccatgctcctgccgtaatgatcgccgagaagggc
gcctatctgctgaagagggcctggggcgccaaggtctga

DBGET integrated database retrieval system