KEGG   Drosophila erecta: 6551414
Entry
6551414           CDS       T01060                                 

Definition
(RefSeq) probable 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6551414
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     6551414
SSDB
Motif
Pfam: Glucosamine_iso DUF2290
Other DBs
NCBI-GeneID: 6551414
NCBI-ProteinID: XP_001977200
FlyBase: FBgn0110588
UniProt: B3NVD9
LinkDB
Position
Unknown
AA seq 243 aa
MSERKSPLKVIPSASEEQLVQALGDLLKRCSQEALSRKDKFSVGLSGGSLIQLLTKALKS
GNLKTADWVFFFCDERYVPLDDNDSTYGAYRAEWLTQLPCIQESQFVRADTSKPLDACAA
DYEAKVKSQVDQFDLLLLGMGPDGHTCSLFPEQPATLQETKCLVIPIRNSPKPPPERITF
TLPLINNARNVAFVVTGAGKASVVKSVFVDLDKKFPAAWVNPTKGQLTLIVDAGAGEEIT
ALN
NT seq 732 nt   +upstreamnt  +downstreamnt
atgtcggagcgaaagagtccgctaaaggtaatcccgtccgcttcggaggagcaactggtc
caggccctgggcgatctactgaagcgctgctcccaggaggcgttgtccagaaaggataaa
ttcagcgtgggactttcgggtggttccctcattcagttgcttacaaaagctctgaaatct
ggcaacttgaaaaccgccgactgggtgttcttcttctgcgacgagcggtatgttcccctg
gatgataacgattccacctacggtgcctacagggccgagtggttgacccaattgccttgt
attcaggaatcccagttcgtccgcgccgataccagcaaaccgctggacgcctgcgccgca
gattacgaggcgaaggtcaagagccaagtcgatcagttcgatctgctgctgctgggaatg
ggacccgatggccacacctgctccctcttccccgagcagccagccacgctgcaggagacc
aaatgcctggtcatccccatacggaactcgcccaagccaccacccgagaggatcaccttc
accctgccgctgatcaataatgcccggaatgtcgccttcgtggttacgggcgccggaaaa
gccagcgtcgtcaagagcgtgtttgtggatctggataagaagtttcccgctgcgtgggtg
aatccaacaaagggacagttgacgttgattgtggacgcgggagctggagaagaaattaca
gctttaaattga

DBGET integrated database retrieval system