KEGG   Drosophila erecta: 6551925Help
Entry
6551925           CDS       T01060                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
der  Drosophila erecta
Pathway
der00040  Pentose and glucuronate interconversions
der00051  Fructose and mannose metabolism
der01100  Metabolic pathways
Module
der_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    6551925
   00051 Fructose and mannose metabolism
    6551925
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     6551925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 6551925
NCBI-ProteinID: XP_001980623
FlyBase: FBgn0110035
UniProt: B3NZK8
LinkDB All DBs
Position
Unknown
AA seq 360 aa AA seqDB search
MATDNLTAVLHGIEDLRLEQRPVPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK
PMIIGHEAAGVVAKLGKNVTTLQVGDRVAIEPGVPCRYCDHCKQGRYNLCADMVFCATPP
YDGNLTRYYKHAADFCFKLPDHVSMEEGALLEPLSVGVHACRRAGVGLGSKVLILGAGPI
GLVTLLAAQAMGASEILITDLVQQRLDVAKELGATHTLLLQRDQSAEETVKVVHQTMSEV
PDKSIDCCGAESSARLAIFATRSGGVVVVVGMGAPEIKLPLINALAREIDIRGVFRYCND
YSAALALVASGKVNVKRLVTHHYDITETAEAFETSRRGTGGAIKVMIHVQPRDANNKVKF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagataatttaacagcggttctccacggcatcgaggacctgcgattggagcaa
cgcccagttccggaaatcgccgacgatgaggttctcctggccatggacagcgtgggcatc
tgcggatccgacgtgcactacctggcccacggacgcatcggggactttgtgctgaccaag
ccgatgatcattggccacgaggcagccggcgtggtggccaagctgggcaagaacgtgacc
accctgcaggtgggcgaccgcgtggccattgagccgggagtgccctgccgctactgcgat
cactgcaagcagggtcgctacaacctgtgcgccgacatggtcttttgcgccacacctccg
tacgatggcaacctgaccaggtactacaaacacgccgccgacttctgcttcaagctgccg
gatcacgtcagcatggaggagggtgccctcctggagcccctgtccgtgggagttcacgcc
tgccgtcgcgcaggcgtcggtctgggctcaaaggtgctcatcctgggcgctggccctatt
ggtttggttacgctgctggctgcccaagccatgggtgcctctgagatcctcatcaccgat
ctggtgcagcagcgcttggatgtggccaaggagctgggcgccacacacacgctgctcctg
cagcgggatcagtccgccgaggagaccgtcaaggtggttcaccagacgatgagcgaggtg
ccggacaagtccatcgattgctgcggagccgagagcagcgcccgcctggccatcttcgcc
actcgctccggcggagtagttgtggttgtgggcatgggcgctcccgagatcaaactgccc
ctgatcaacgctttggcacgtgagatcgacatccgtggcgtcttccgctactgcaatgac
tattccgccgctttggctctggtggcatcgggcaaggtgaacgtgaagcgtctagtgacg
caccactacgacatcacggagacggctgaggcgtttgagacctcccgccgcggcaccgga
ggcgctatcaaggtcatgatccacgtccagccgagggacgcgaacaacaaagtcaagttc
tga

DBGET integrated database retrieval system