KEGG   Drosophila erecta: 6553450Help
Entry
6553450           CDS       T01060                                 

Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
der  Drosophila erecta
Pathway
der00230  Purine metabolism
der00250  Alanine, aspartate and glutamate metabolism
der01100  Metabolic pathways
Module
der_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6553450
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    6553450
Enzymes [BR:der01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     6553450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 6553450
NCBI-ProteinID: XP_001979377
FlyBase: FBgn0107347
UniProt: B3P321
LinkDB All DBs
Position
Unknown
AA seq 447 aa AA seqDB search
MSASATNGTHYEQLHQGRTKMYKSKVDVVLGAQWGDEGKGKVVDMLASDVDIVCRCQGGN
NAGHTVVANGTEFDFHLLPSGVVNEKCVSVIGNGVVIHLPSLFDEVLKNEAKGLQHLENR
LIISDRAHLVFDFHQHVDGMQEAEKGGKSLGTTKKGIGPAYSSKATRNGIRVGELLGDFN
LFSEKFKSIVATHVRLFPSINVDVEAELARYKDYADKVRPYVKDTICFLHTALRNGKTIL
VEGANAAMLDIDFGTYPYVTSSNCSIGGVLTGLGLPPQTIGEVIGVVKAYTTRVGDGPFP
TEQLNDIGDLLQTRGFEIGVTTKRKRRCGWLDIPLLKYTSLVNGYTCICVTKLDILDTLP
EIKVAVAYKKPSGEKLDHFPGTIAELGNIEVEYAVLPGWQTSTEDVRNFKELPENAQSYV
RFLESELSVPVRWVGVGKGRESIINVH
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccagcgccaccaacggcacgcactacgagcagctgcaccagggccgcaccaag
atgtacaagtcgaaggtggacgtcgtcctgggagcccagtggggcgacgagggcaagggc
aaagtggtggacatgctggcctctgatgtggacatcgtctgcaggtgtcagggcggcaat
aacgctggacacactgtggtggctaatggcacggagttcgacttccatctcctgcccagt
ggtgttgtgaacgagaagtgcgtttccgtcatcggcaatggcgtcgtcattcacctgccc
tcgctgttcgacgaggtgctgaagaacgaagccaaggggctgcagcatctagagaaccgg
ctgatcatctcagaccgtgcccacctggtgttcgacttccatcagcatgtggatggcatg
caggaggctgagaagggcggcaagtcgctcgggaccaccaagaagggcattggtccggcc
tactctagcaaggctacccgcaacggcatccgagtgggagagctgctcggtgacttcaac
ctcttcagtgaaaagttcaagtcgattgtggccactcacgtgcgcctgttcccatcgatt
aacgtggacgtagaggcggagctggcccgctacaaggactacgcagataaggtgcgtccc
tatgtcaaagacaccatttgcttcctgcacaccgccctgcgcaacggcaagacgatcttg
gtcgaaggtgccaacgcggccatgctggacattgacttcggcacgtatccgtatgtgacg
agcagcaactgcagcattggcggtgttctcacgggcttgggtttgcccccacagacgatt
ggcgaggtaattggcgtggtcaaggcttatacgacgcgagtgggcgacggtccattcccc
accgagcaacttaatgatattggggacttgctgcaaacgcgtggcttcgaaatcggtgtc
acaaccaagcggaagcgccgctgtggctggttggacataccgctgctgaagtacacctcg
ctggtcaacggctacacttgcatctgtgtcaccaagctggatattctcgacacgcttcca
gagatcaaggtggccgtggcctacaagaagcccagtggcgagaagcttgaccacttcccc
ggcaccatagccgagcttggaaacattgaggtggagtacgctgtgctgccaggctggcag
acatccactgaggatgtgcgtaacttcaaggagctgccggagaatgcccagagctatgtc
cggtttctggagagcgagctgagcgtgcccgtgcgctgggtgggagttggaaagggtcgt
gagtccatcatcaatgtgcattaa

DBGET integrated database retrieval system