KEGG   Drosophila erecta: 6554134
Entry
6554134           CDS       T01060                                 

Definition
(RefSeq) fructose-bisphosphate aldolase isoform X3
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00030  Pentose phosphate pathway
der00051  Fructose and mannose metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
Module
der_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
der_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6554134
   00030 Pentose phosphate pathway
    6554134
   00051 Fructose and mannose metabolism
    6554134
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:der04131]
    6554134
   03036 Chromosome and associated proteins [BR:der03036]
    6554134
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6554134
Enzymes [BR:der01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     6554134
Membrane trafficking [BR:der04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    6554134
Chromosome and associated proteins [BR:der03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    6554134
Exosome [BR:der04147]
 Exosomal proteins
  Proteins found in most exosomes
   6554134
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 6554134
NCBI-ProteinID: XP_015009248
LinkDB
Position
Unknown
AA seq 361 aa
MTTYFNYPSKELQDELRDIAQRIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYR
QLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSE
DEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQS
QRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSA
KKNTPQEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFS
YGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHA
Y
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaccacctacttcaactaccccagcaaggagctgcaggatgagctgcgcgacatcgcc
cagcggatcgtggcccccggcaagggaatcctcgccgccgacgagtccggcccaaccatg
ggcaagcgtctgcaggacatcggcgtggagaacaccgaggacaaccgccgtgcctaccgt
cagctgttgttcagcactgaccccaagctggccgagaacatctccggagtgatcctgttc
cacgagaccctctaccagaaggccgacgatggcacccccttcgccgagatcctgaagaag
aagggcatcattctgggcatcaaggtcgacaagggtgtggtcccactgttcggctccgag
gatgaggtcaccacccagggtctggatgacctggccgcccgttgcgcccagtacaagaag
gacggttgcgacttcgccaagtggcgttgcgtcctcaagatcggcaagaacaccccatcc
taccagtcgatcctggagaacgccaatgtcctggcccgctacgcttccatctgccagtcg
cagcgcatcgtcccaattgtggagcccgaggttctgcccgatggcgatcacgatctggac
cgcgcccagaaggtcaccgagaccgtcctggccgccgtctacaaggccctgagcgaccac
cacgtctacctggagggtaccctgctgaagcccaacatggtcaccgccggtcagtcggcc
aagaagaacaccccccaggagatcgccctggccaccgtgcaggctctgcgccgcaccgtt
cccgccgccgttaccggcgtgaccttcctgtccggaggtcagtccgaggaggaggccacc
gtcaacctgagcgccatcaacaacgttcccctgatccgcccatgggccctgaccttctcg
tacggtcgtgccctccaggcctccgtcctgcgtgcctgggctggaaagaaggagaacatc
gccgccggccagaacgagctgctcaagcgcgccaaggccaacggtgatgccgctcagggc
aagtacgttgccggaagtgctggtgccggatccggatccctgttcgtggccaaccacgcc
tactaa

KEGG   Drosophila erecta: 6554260
Entry
6554260           CDS       T01060                                 

Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00030  Pentose phosphate pathway
der00051  Fructose and mannose metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
Module
der_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
der_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6554260
   00030 Pentose phosphate pathway
    6554260
   00051 Fructose and mannose metabolism
    6554260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:der04131]
    6554260
   03036 Chromosome and associated proteins [BR:der03036]
    6554260
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6554260
Enzymes [BR:der01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     6554260
Membrane trafficking [BR:der04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    6554260
Chromosome and associated proteins [BR:der03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    6554260
Exosome [BR:der04147]
 Exosomal proteins
  Proteins found in most exosomes
   6554260
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 6554260
NCBI-ProteinID: XP_001981681
FlyBase: FBgn0103771
UniProt: B3P681
LinkDB
Position
Unknown
AA seq 364 aa
MTTHFYYPNKELQEELICISKALVAPGKGILAADESSAVMGKRFQLIGVENTEENRRVYR
QMLFTTDPKIAENISGVIFYHETLHQRTDDGLPFVEALRKKGILTGIKVDKHFSPLFGSE
DEFTTQGLDDLANRCAQYKKEGCSFAKWRCILKITKNTPSPQAILENANVMARYAAICQS
QRLVPIISPEVLATGDHDLDRCQKVNEILLAGVYKALSDHHVFLEGTLLQPSMVMPGLQS
NKNHPASDIGMATVLAIRRTVPPAVMGVVFCSGAQSEEEASVHLNAINNVPLCKPWAMSF
AFDRALQTSILRTWGGKKEQITHAQNELIKRCRANGLASIGKYVIGSVESSAATERLIQE
AVEF
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgacgacccatttctactacccgaacaaggagctgcaggaggaactcatctgcatatcg
aaggcgttggtggctcctggaaagggtatcctggcggccgacgagtccagtgcagtgatg
ggcaagcgattccagctgatcggtgtggagaacacggaggagaatcgccgggtataccgc
caaatgctattcaccaccgatccaaagatagcggagaatatatcaggcgtgatattctac
catgaaacactgcatcaacgtacggatgatggactgccatttgtagaggccctcagaaag
aagggcatcctgacgggaatcaaggtggacaagcatttttcaccactcttcggctctgag
gatgagtttaccactcagggactggatgatctggccaatcgatgtgcccagtacaagaag
gagggctgcagctttgccaagtggcggtgcatcctgaagatcaccaagaatactccttca
ccgcaggctattttggaaaacgccaatgtcatggcccggtatgcagccatctgccaatcg
cagcgactggtgcccatcattagtcccgaggtcctggctaccggggatcatgacttggat
cggtgtcagaaggtcaacgaaatcctcctggctggagtgtacaaggctcttagtgatcac
cacgttttccttgagggaactcttttgcagcccagcatggtgatgcctggactgcagagc
aataagaaccatccagcctcggatattggaatggctacagttctcgccattagacgaact
gtgcctccggccgttatgggagtcgtcttttgtagtggggctcaatcagaagaggaggcc
tcggtccatttgaatgccattaacaatgtgccgctctgtaagccttgggccatgagcttt
gcctttgatcgggcacttcaaacatcgattttaaggacttggggtggcaagaaggagcag
atcacccatgctcaaaatgaactcatcaaacgatgcagggctaatggtctggcaagcatt
gggaaatatgtaattgggtccgtggaaagctcagcggccactgaaagactcattcaagaa
gccgtcgaattctaa

DBGET integrated database retrieval system