KEGG   Drosophila erecta: 6555344Help
Entry
6555344           CDS       T01060                                 

Definition
(RefSeq) serine protease 1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
der  Drosophila erecta
Pathway
der04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:der00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6555344
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:der01002]
    6555344
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6555344
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     6555344
Peptidases [BR:der01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   6555344
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6555344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 6555344
NCBI-ProteinID: XP_001981194
FlyBase: FBgn0104049
UniProt: B3P581
LinkDB All DBs
Position
Unknown
AA seq 267 aa AA seqDB search
MKLFVFLALAVAAATAIPTPDQKLVPTPVKDLKIEGRITNGYPAYEGKVPYIVGLLFSGN
GNWWCGGSIIGNTWVLTAAHCTSGANGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSG
NLHNDISLIRTPHVDFWHLVNKVELPSLNDRNRDYAGWWAVASGWGGTYDGSPLPDWLQS
VDVQIISQGECSRTWSLHDNMICISTNGGKSTCGGDSGGPLVTHDGNRLVGVTSFVSGNG
CQSGAPAVFSRVTGYLDWIRDNTGISY
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttcgtattcctggctctggccgtggccgccgccactgccattcctaccccg
gaccagaagttggtccccaccccggtgaaggacctcaagatcgagggtcgcatcaccaac
ggctacccagcctacgagggcaaggtgccctacatcgtgggtctgctcttcagcggcaac
ggaaactggtggtgcggtggctccatcatcggcaacacctgggtgctgaccgccgcccac
tgcaccagcggagccaacggagtgaccatcaactacggagccagtctgcgcaaccagccc
cagtacacccactgggtgggcagcggaaacttcgtccagcaccaccactacaacagcggc
aacctgcacaacgacatctccctgatccgcaccccgcacgtcgacttctggcacctggtc
aacaaggtggagctgcccagcctcaacgaccgcaaccgcgactacgccggatggtgggcc
gtggcctccggatggggcggcacctacgatggcagcccactgcccgactggctccagtcc
gtcgatgtccagatcatttcccagggtgagtgcagccgcacctggtccctccacgacaac
atgatctgcatcagcaccaacggcggaaagtccacctgcggaggcgactccggtggcccc
ctggtcacacacgacggcaaccgcctggtcggagtgacatccttcgtgtccggcaacggc
tgccagtctggtgctcctgctgtcttcagccgcgtcaccggatatctcgactggatccgc
gacaacaccggcatctcgtactaa

DBGET integrated database retrieval system