KEGG   Drosophila erecta: 6555625
Entry
6555625           CDS       T01060                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der00480  Glutathione metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6555625
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6555625
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     6555625
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     6555625
SSDB
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 F420_oxidored
Other DBs
NCBI-GeneID: 6555625
NCBI-ProteinID: XP_001982603
FlyBase: FBgn0105183
UniProt: B3P8W7
LinkDB
Position
Unknown
AA seq 481 aa
MSGQADIALIGLAVMGQNLILNMDEKGFVVCAYNRTVAKVKEFLANEAKGTNVIGADSLQ
DMVSKLKSPRKVMLLVKAGSAVDDFIQQLVPLLSAGDVIIDGGNSEYQDTSRRCEELAKL
GLLYVGSGVSGGEEGARHGPSLMPGGHEAAWPLIQPIFQAICAKADGEPCCEWVGDGGAG
HFVKMVHNGIEYGDMQLICEAYHIMQSLGLSADQMADEFGKWNSAELDSFLIEITRDILK
YKDGKGHLLERIRDTAGQKGTGKWTAIAALQYGVPVTLIGEAVFSRCLSALKDERVQASS
LLKGPSTKAQVANLAKFLDDIKHALYCAKIVSYAQGFMLMREAARENKWRLNYGGIALMW
RGGCIIRSVFLGNIKDAYTSQPQLSNLLLDDFFKKAIERGQDSWREVVANAFRWGIPVPA
LSTALSFYDGYRTAKLPANLLQAQRDYFGAHTYELLGQEGQFHHTNWTGTGGNVSASTYQ
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgagcggacaagcagacatcgccctcatcggcctggccgtcatgggccaaaacctgata
ctcaacatggacgagaagggattcgtggtgtgcgcctacaaccgcacggtggccaaggtc
aaggagttcctcgccaatgaggccaaaggcaccaacgtgattggcgccgactcgctccag
gacatggtctccaagctgaagagcccccggaaggtcatgctgctggtcaaggctggaagt
gcggtcgacgactttatccagcagctggtgccgctgctctcggccggcgatgtgatcatc
gatggaggcaactcggagtatcaggacacatctcgccgttgcgaagagttggccaaactt
ggcctgctctatgtgggatccggcgttagcggcggcgaggagggagcccgccacggacca
tcgctgatgcccggcggacacgaggccgcgtggcccctgattcagcccatcttccaggct
atctgcgccaaggccgacggtgaaccctgctgcgagtgggtgggcgatggaggcgccggt
cactttgtcaagatggtgcacaacggcatcgaatacggcgacatgcagctgatctgtgag
gcgtaccacattatgcagagcctgggcctgtcggctgaccagatggccgacgagttcggc
aagtggaactcggccgaactggactccttcctcatcgaaattacgcgcgatattctcaag
tacaaggacggcaaaggtcatctgctggagcggattcgcgacaccgccggccagaagggc
acaggcaagtggacggccattgctgctctgcagtacggagtacctgtgacgctaattggc
gaggcggtcttctcgcgatgcctgtctgcccttaaggacgagcgcgttcaggccagcagc
ttgctgaagggaccatcgaccaaggcgcaagttgccaacctcgccaagttcctcgacgac
atcaagcacgctctctactgcgccaagatcgtgtcgtacgcgcagggattcatgctgatg
cgagaggcggccagggagaacaagtggaggctcaactacggcggcattgcgctgatgtgg
cgcggcggctgtatcatccgcagcgtctttctgggcaacatcaaggacgcgtatacgtcg
cagccgcagctgtccaacctgctgctggacgacttcttcaagaaggccatcgagcgcggc
caggactcgtggcgcgaggtcgttgccaatgccttccgctggggcatccccgtgccggct
ctgtccaccgccctaagcttctacgatggctatcgcacggccaagctgccagccaacttg
ctgcaggcccagagggattactttggagcccacacctatgagctgctgggccaggagggc
cagttccaccacacgaactggacgggcaccggcggcaatgtgtccgccagcacctaccag
gcgtag

DBGET integrated database retrieval system