KEGG   Drosophila erecta: 6555652Help
Entry
6555652           CDS       T01060                                 

Definition
(RefSeq) armadillo segment polarity protein isoform X1
  KO
K02105  catenin beta 1
Organism
der  Drosophila erecta
Pathway
der04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6555652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Adaptin_N HEAT_2 Cnd1 KAP Arm_2 Atx10homo_assoc PUL
Motif
Other DBs
NCBI-GeneID: 6555652
NCBI-ProteinID: XP_015008740
FlyBase: FBgn0104958
UniProt: B3P8S9
LinkDB All DBs
Position
Unknown
AA seq 843 aa AA seqDB search
MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGK
EDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPST
QFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQAA
MMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIF
KSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVK
FLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSS
NKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST
DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLT
SRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGA
IHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNR
ALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSR
NEGVATYAAAVLFRMSEDKPQDYKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGP
EEAYEGLYGQGPPSVHSSHGGRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAPGNGGA
VGGASGGGGNIGAIPPSGAPTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYD
TDC
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgagttacatgccagcccagaatcgaaccatgtcgcataataatcaatacaatccacct
gatctgccgccgatggtgtccgccaaggagcagaccctcatgtggcagcagaactcatac
ttgggcgactccggcatccactcgggtgccgtgacccaggtgccatcgctgtctggcaag
gaggacgaggagatggagggagatccgcttatgttcgacctggacaccggtttcccacag
aattttacacaagaccaagtggacgatatgaaccagcagctcagccagactcgctcccaa
cgtgtccgtgctgccatgtttccggaaaccctggaggagggcattgagattccctccacc
cagtttgatccccaacagccgacggcagtgcaacgtctttcggagccgtcgcaaatgcta
aagcacgcggtggtcaatctgatcaactaccaggacgacgctgagctggcaaccagggcc
atacccgagttaatcaagctgctgaacgatgaggatcaggtggtagtttcccaggccgcc
atgatggttcaccagctgtccaagaaggaggcctcgcgccacgccataatgaacagcccc
cagatggtagccgctttggtgcgtgccatctcgaacagcaacgatctggagagcaccaag
gcagctgtaggaacgctgcacaacttatcacaccatcgtcagggtctgctggccatcttc
aagagtggcggcatcccggcactcgtcaagttgctctcctcgccagtggagagtgtgttg
ttctatgcaattaccacgctgcacaatctgctgctccaccaggatggatccaagatggct
gtgcgcctggctggtggtcttcagaagatggttacactgctgcaacgaaacaacgtcaag
tttctggctatcgtcacagattgcttgcaaattctggcctatggtaaccaggagagcaag
ttgataatccttgcctccggtgggccgaacgaactggtacgcatcatgcgctcttacgac
tacgagaagctactgtggaccacttcgcgtgtactgaaagtgctttccgtttgttcgagt
aacaagccggccatcgtggatgccggtggaatgcaggcgctggctatgcacttgggtaac
atgtcgccgcgtcttgtgcaaaactgtttgtggactctccgcaacctgtcggatgcagcc
actaaggtggagggcctcgaagctttgcttcaatctcttgtccaggttctgggctcgacc
gatgtcaacgtggtcacctgtgccgccggtattctctcaaatctgacgtgcaacaatcag
cgcaacaaggccaccgtttgccaggtgggcggtgtggacgccctcgtccgtactatcatc
aatgctggagatcgcgaagagattaccgagccggccgtctgtgccctacgtcacttgacc
tcacgtcatgtggactcggagctggcccagaatgccgtgcgtcttaactacgggctatcg
gtgattgtgaagcttctgcatccaccatcacgctggcccttgatcaaggccgtcattggg
cttatacgcaatttggccctctgtccggccaatcacgccccgttgcgggagcacggggcc
atccaccatctggtgcggctgctaatgcgagccttccaagacacagagaggcaacgttcc
tcgatagccaccacgggctcacagcagccgtctgcatacgctgacggcgttcgtatggag
gagattgtcgagggcacggtgggggcgctacatatcctggcccgtgagtcccacaaccgg
gcactcatacgccagcagtcggtaataccgatcttcgttcgcttgctgttcaacgaaatc
gagaacatacagcgcgtggctgctggcgttctttgtgagctcgccgctgacaaggagggc
gccgagattatcgagcaggagggcgccactgggccgctgaccgatctcctgcattcgcgc
aatgaaggcgtggccacatacgccgccgccgttctcttccgcatgagtgaggacaagccg
caggattacaagaagcggttatccatagagctgaccaactcgctgctgcgcgaggacaac
aacatatgggccaatgccgacctgggcatgggtcccgatctgcaggatatgcttggacca
gaagaagcatatgagggcctgtacggacaaggtccgcccagcgtgcacagttcgcacgga
ggtcgcgcattccatcagcaaggatatgatactctaccaatagattcgatgcagggtctg
gagatcagcagcccggtgggcggtggcggtgctgggggtgctcccggcaatggtggagct
gtgggcggagctagcggcggcggtggtaacatcggcgccattccgcccagcggcgcaccc
acatcgccctattccatggacatggacgtcggcgagattgatgccggtgcattgaacttc
gacttggacgccatgccgacgccacccaatgacaacaacaacctggctgcctggtacgat
accgactgttag

DBGET integrated database retrieval system