KEGG   Drosophila erecta: Dere_GG12388Help
Entry
Dere_GG12388      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
der  Drosophila erecta
Pathway
der00220  Arginine biosynthesis
der00250  Alanine, aspartate and glutamate metabolism
der00471  D-Glutamine and D-glutamate metabolism
der00910  Nitrogen metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Dere_GG12388
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dere_GG12388
   00220 Arginine biosynthesis
    Dere_GG12388
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dere_GG12388
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    Dere_GG12388
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     Dere_GG12388
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dere_GG12388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog
Motif
Other DBs
NCBI-GeneID: 6555203
NCBI-ProteinID: XP_001982071
FlyBase: FBgn0104676
UniProt: B3P8B7
LinkDB All DBs
Position
Unknown
AA seq 562 aa AA seqDB search
MYHLKSLARQGALRQQELATLAKALPTAVMQSSRGYATEHQIPDRLKDVPTAKDPRFFDM
VEYFFHRGCQIAEESLVDDMKGKLTRDEKKQKVKGILMLMQPCDHIIEIAFPLRRDAGNY
EMITGYRAQHSTHKTPTKGGIRFSLDVSRDEVKALSALMTFKCACVDVPFGGAKAGLKIN
PKEYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTIGHLDI
NAHACVTGKPINQGGIHGRVSATGRGVFHGLENFINEANYMSQIGTTPGWGGKTFIVQGF
GNVGLHTTRYLTRAGATCIGVIEHDGTLFNPEGIDPKLLEDYKNEHGTIVGYQNAKPYEG
ENLMFEKCDIFIPAAVEKVITSENANRIQAKIIAEAANGPTTPAADKILIDRNILVIPDL
YINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLASVQQSIERIINDESVQESLE
RRFGRVGGRIPVTPSESFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKYNLGLDLR
TAAYVNSIEKIFTTYRDAGLAF
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacctgaagagtctggcccgccagggcgccctccgccagcaggagctggccacg
ctggctaaagccctgcccacggccgtgatgcagtcgagccgtggctatgccaccgaacat
cagatacccgatcgcctcaaggatgtgcccaccgccaaggatccgcgcttctttgacatg
gtcgagtacttcttccatcgcggctgccaaatcgccgaggagtcgctggtggacgacatg
aagggcaagctgacccgcgacgagaagaagcagaaggtgaagggcatcctcatgctgatg
cagccctgcgaccacatcatcgagatcgccttccccctgcgccgcgatgccggcaactac
gagatgatcaccggctaccgtgcccagcacagcacccacaagacgcccaccaagggaggc
atccgtttctcgttggatgtgtcacgcgatgaggtcaaagccctgtctgccctgatgacc
ttcaagtgcgcctgcgtggatgtgccattcggcggtgccaaggctggcctgaagatcaac
cccaaggagtactccgagcacgagctggagaagatcacccgtcgcttcacccttgagttg
gccaagaagggcttcattggacccggcgtcgatgtgcccgcccccgacatgggaaccggc
gagcgcgagatgtcctggattgccgatacttatgccaagaccatcggtcacctggacatc
aatgcccatgcctgtgtcaccggcaagcccatcaaccagggcggcatccacggacgcgtc
tcggccaccggtcgcggtgtcttccacggcctggagaacttcatcaacgaggccaactac
atgagccagatcggcaccactcccggctggggcggcaagaccttcatcgtccagggcttc
ggaaacgtgggcctgcacaccacccgctatctgacccgcgccggtgccacctgcatcgga
gtcattgagcacgacggcactctgttcaacccggagggcattgaccccaagctgctggag
gactacaagaacgagcacggcaccattgtgggctaccagaacgccaagccctacgagggc
gagaacctcatgttcgagaagtgcgacatcttcattccggctgccgtcgagaaggtcatc
accagcgagaatgccaaccgtatccaagctaagatcattgccgaggctgccaacggcccc
accacccccgctgccgacaagatcctcatcgatcgcaacatcctggtcatccccgatctg
tacatcaacgccggcggtgtcaccgtctccttcttcgagtggctgaagaacctgaaccac
gtctcgtacggtcgcctgaccttcaagtatgagcgcgagtccaactaccatctgctcgcc
tcagtccaacagtcaattgaaagaatcattaatgacgaatccgtgcaagagtccctggag
cgtcgtttcggccgtgtgggcggtcgcatccccgtgaccccatccgagtcgttccagaag
cgcatctccggcgcctccgagaaggacatcgtgcactccggcctggactacaccatggag
cgctccgcccgcgccatcatgaagacggccatgaagtacaacctgggcctggacctcaga
accgctgcctatgtcaactccattgagaagatcttcaccacataccgcgatgccggcctg
gccttctaa

DBGET integrated database retrieval system