KEGG   Drosophila erecta: Dere_GG13014Help
Entry
Dere_GG13014      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11253  histone H3
Organism
der  Drosophila erecta
Brite
Chromosome and associated proteins [BR:der03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dere_GG13014
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dere_GG13014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa PAF
Motif
Other DBs
NCBI-GeneID: 6556072
NCBI-ProteinID: XP_001982932
FlyBase: FBgn0105287
UniProt: B3PAD8
LinkDB All DBs
Position
Unknown
AA seq 271 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGSEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG
TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLF
EDTNLCAIHAKRVTIMPKDIQLARRIRGERA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtacgaagcaaactgcacgcaaatcgactggtggaaaagcgccacgcaaacaa
ctggctactaaggccgctcgcaagagtgcccctgcgaccggaggtgtgaagaagccccat
cgctatcgccctggaacagtggccttgcgtgagatccgtcggtaccaaaagagcactgag
cttttgatccgcaaactgccttttcagcgtctggtgcgtgaaatcgctcaggattttaag
actgatttgcgattccagagctcggcggttatggccctgcaagaagctagcgaagcctat
ctggttggtctctttgaagataccaacttgtgtgccattcatgccaagcgtgtcaccatt
atgcccaaggacatccaattagcgcgacgcatccgcggctcggaaatggcccgtacgaag
caaactgcacgcaaatcgactggtggaaaagcgccacgcaaacaactggctactaaggcc
gctcgcaagagtgcccctgcgaccggaggtgtgaagaagccccatcgctatcgccctgga
acagtggccttgcgtgagatccgtcggtaccaaaagagcactgagcttttgatccgcaaa
ctgccttttcagcgtctggtgcgtgaaatcgctcaggattttaagactgatttgcgattc
cagagctcggcggttatggccctgcaagaagctagcgaagcctatctggttggtctcttt
gaagataccaacttgtgtgccattcatgccaagcgtgtcaccattatgcccaaggacatc
caattagcgcgacgcatccgcggcgagcgtgcttaa

DBGET integrated database retrieval system