KEGG   Drosophila erecta: Dere_GG22650Help
Entry
Dere_GG22650      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
der  Drosophila erecta
Pathway
der04146  Peroxisome
der04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:der00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dere_GG22650
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dere_GG22650
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dere_GG22650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD DUF43 TRI9
Motif
Other DBs
NCBI-GeneID: 6546872
NCBI-ProteinID: XP_001976064
FlyBase: FBgn0114821
UniProt: B3NSG2
LinkDB All DBs
Position
Unknown
AA seq 217 aa AA seqDB search
MLQYLVVSLALCATICSAAQTRNMPIQAIAYLTGPVQSDNTQVKGNVTFTQNDCGQNVHV
RVQLEGLKEGKHGFHIHEKGDLTNGCLSMGGHYNPDKVDHGGPDHEVRHVGDMGNLEANS
SGIIDVTYTDPVITLTGKQAIIGRGVVVHELEDDLGLGNHTDSKKTGNAGGRIACGVIGI
NSDVDEWPCRDGGAGALRYSFSILTLVVAIFLARSLD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaatatctcgttgttagcctggcactttgcgccacaatttgctctgctgcgcag
acgcgtaatatgcccatacaagccattgcctatctgaccggacccgtgcaatcggataat
acccaggtcaagggcaacgtgaccttcacgcagaacgactgtggccagaatgtccatgtg
cgcgtccagctggagggattgaaggagggcaagcacggcttccacatccacgagaagggg
gatctgaccaacggatgcctcagcatgggtggtcactataatcccgacaaggtggatcac
ggtggccccgaccacgaggtgcgtcatgttggcgatatgggcaacctggaggccaactcc
tcgggcatcatcgacgtcacatacacggatccggtgatcaccctaactggcaagcaggcg
atcattggcaggggagttgtggtccacgaactggaggatgatctcggcctgggcaatcac
acggactccaagaagaccggcaatgctggcggccgcattgcctgcggtgttattggcatc
aactcggatgtggacgagtggccatgtcgcgatggtggcgccggcgccctgcgctactcc
ttctccatcctgaccctcgtcgtggccatcttcttggcccgcagccttgactaa

DBGET integrated database retrieval system