KEGG   Drosophila erecta: Dere_GG22898Help
Entry
Dere_GG22898      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
der  Drosophila erecta
Pathway
der03030  DNA replication
der03410  Base excision repair
der03420  Nucleotide excision repair
der03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dere_GG22898
   03410 Base excision repair
    Dere_GG22898
   03420 Nucleotide excision repair
    Dere_GG22898
   03430 Mismatch repair
    Dere_GG22898
Enzymes [BR:der01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dere_GG22898
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dere_GG22898
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dere_GG22898
DNA replication proteins [BR:der03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dere_GG22898
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dere_GG22898
DNA repair and recombination proteins [BR:der03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dere_GG22898
   NER (nucleotide excision repair)
    Other NER factors
     Dere_GG22898
   MMR (mismatch exicision repair)
    Other MMR factors
     Dere_GG22898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 UPF0128
Motif
Other DBs
NCBI-GeneID: 6548210
NCBI-ProteinID: XP_001976489
FlyBase: FBgn0115055
UniProt: B3NQ16
LinkDB All DBs
Position
Unknown
AA seq 747 aa AA seqDB search
MQKSITSFFKKKSDATDSPSPPKKVPKIDAKAELLDEPLIKSESASPEAKANVEPMSVDS
EEKASPVKNVKKEPKDVEDRITDKKVTTIGLNSTSASKEDMENYDPSADSYHPLKNAYWK
DKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAY
EGLELGVAETTLMKAICKATGRNLAHIKSQTHLIGDLGIVAEQSRVSQRMMFQPAPLNVR
DVFRKLREIAKISGQSKMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIG
LVKKNHIDECKASKVPEVYKDEIAETTLLLKTAYCQCPNYDIIIPAILKYDIKELQDRCP
MHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSEN
NTAKYPDLIARSTGLLKGDVQSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKV
QVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEE
SIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTG
TYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTDTAKSYYRYDQSLEPD
HWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQV
AHMYQSQDQVKNNQKSSTQMEMEDEFY
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtctataacctccttcttcaagaagaaatccgatgccaccgacagcccttcg
ccgccgaagaaagttcccaagatcgatgcgaaggctgaactcttagatgagcccctcatc
aagagcgagagtgcctccccggaagctaaggccaatgtagaacctatgtctgtggattcc
gaggagaaggcaagtccagtgaagaatgttaagaaggagccaaaggatgtcgaggacaga
atcactgacaagaaggtcacaaccataggtcttaactccacttccgcttctaaggaggat
atggaaaactacgacccatccgctgattcctatcatccactcaagaatgcttactggaag
gacaaaaaggtcactccctacttggcactggcccgcacatttcaagtaatcgaggagacc
aaaggccggcttaagatgatcgacacgctgagcaacttcttctgctcggtgatgctggtc
agtccggaggatctggtgcccagcgtgtaccttagcatcaaccaactggcgcccgcatat
gagggactggagctgggcgtagccgagaccaccttgatgaaggccatttgcaaggccacg
ggccgcaatttggctcacataaaatcacagacgcacctaatcggggatctgggcatcgtg
gccgagcagtcgcgcgtttcgcagcgcatgatgttccagccagcacccttgaatgtgaga
gatgtgttccgaaagctgcgggaaatagctaagatatccggtcagtccaagatggacctg
gtgtacaatatgtttgtggcctgtcgatcgtcggaggctcgtttcttcatccgatctttg
attggcaagcttagaattggcattgccgagcagagtctgctcacggctctggccattggg
ctagtcaaaaagaaccacatcgatgagtgcaaggctagcaaggtgccagaagtctataag
gatgaaatagcagagaccactttgctgctgaaaactgcatactgccaatgtcccaactac
gacatcattattccggccattctaaagtatgatatcaaggagctgcaggatcggtgcccc
atgcatcccggcatgccgctgagacccatgctcgcccagcccaccaagggagtccatgag
gtatttgagagattcggcggcatgcaaatcacctgcgagtggaagtacgatggagagcgg
gcccaaatccatcgaaacgagaagggggagattagcatattctcgcgcaactccgagaac
aacacggcgaagtatccggatttgattgcgaggagcactggcctgctcaagggcgatgta
cagtcctacatcatagacagtgaaattgtggcctgggatgtcgagcgcaaacaaattctg
ccgttccaggttctcagcacgcgcaaacggaagaacgttgatatcgaggaaatcaaggtt
caagtctgtgtctacatattcgatctgctgtacatcaatggcaccgctctggtgaccaaa
aacttgtcagagcgtcgaaagctcctgttagagcatttccaagaggtcgagggcgagtgg
aagttcgccactgcgctggacaccaatgatatcgacgaagtgcagcaatttctagaggaa
tctatcaaagggaattgcgagggcctcatggtcaaaacgttggatgaggaggccacctat
gagattgccaagcgatctcgaaattggctaaaattgaagaaggactacctatccaatgtg
ggcgactcacttgacctagtggttattggcggctacaaaggcaagggccggcgaactgga
acctatggaggatttctacttgcctgctatgataccgagaacgaagagtatcagagcata
tgcaaaattggaacaggcttcaccgacgaggatctgcaaacacattccgagttcttgggc
aagcatgtgaccgacaccgccaaatcctactacagatacgaccaaagtctggagcccgat
cactggtttgaaccggtccaggtgtgggaagttaaatgcgcggatctgtcgctcagcccg
atccaccgagcagccataggcattgtggacggagagcgcggcatttccttgagattccct
cggttcattcggatacgcgacgacaagaacagcgaaaatgcaacggacgccaatcaggtg
gcccacatgtaccagtcgcaggatcaggttaaaaataatcaaaagtcgagcacacagatg
gagatggaggacgagttctactga

DBGET integrated database retrieval system