KEGG   Drosophila erecta: Dere_GG23359Help
Entry
Dere_GG23359      CDS       T01060                                 

Gene name
Dere_Mal-A2
Definition
(RefSeq) maltase A2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
der  Drosophila erecta
Pathway
der00052  Galactose metabolism
der00500  Starch and sucrose metabolism
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dere_GG23359 (Dere_Mal-A2)
   00500 Starch and sucrose metabolism
    Dere_GG23359 (Dere_Mal-A2)
Enzymes [BR:der01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dere_GG23359 (Dere_Mal-A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 6543262
NCBI-ProteinID: XP_001970460
FlyBase: FBgn0115510
UniProt: B3N8P2
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MPKWAHLGLAALLLISTSQGGAADIDWWENASLYQIYPRSFQDSDGDGIGDLKGITSRLG
YLKEIGITATWLSPIFTSPMSDFGYDISNFYDIDPIFGTLDDFDALIVEAKSLGVKIILD
FVPNHSSDENVWFEKSVNREDGYDDFYVWDDGKLNEETGGRDPPSNWVSVFSGPMWTWNE
KRQQFFLHQFQVKQPDLNFTNPMVREHMLDVLKFWLDRGVDGFRIDAVPHIYEHRNADGS
YPDEPVSGWSSDPNAYDYHDHIYTKDQPATVDLMYEWREFLDNYREQNGGDSRVLLAEAY
SSVETLSAYFGNSTHQGTQLPMNFQLMYLSGYSTAEDVVGSIDYWMNTMWKEHQTANWVV
GNHDTNRVADRMGAHEVDLLNVIVNALPGASVTYYGEEIGMSNVDVECTGDSCEDRDGER
TPMQWTAGKNADFSDGQSTWLPLSPEYQRYNVQTERGVSRSSLNIFKGLQALKSSAAFLA
FKEDGGFSYEAVTKQVLQIIRTNKISEEYRILVNMGNDMEILDGLASKTYEYVLVTAYST
HYPGQKAYLSERIILMPYEAVVLRWLA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtgggcacatctcggtctagcggctctccttctaatttccacctcccagggg
ggagctgcggacatcgattggtgggagaacgcctcgctttaccagatatatccgcgctcc
ttccaggacagcgatggcgatggcatcggggacctgaaaggcattacttcgaggctgggc
tatcttaaggaaataggcatcacggccacctggctgtcgcccatttttacctcgcccatg
tcggatttcggctacgacatctccaacttttacgacatcgatccgatattcggcactctc
gacgatttcgatgccctgatagtggaggccaagtcgctgggcgtaaagatcatcctcgac
tttgtacccaaccattccagtgacgagaacgtgtggtttgaaaagtcagtgaatcgcgaa
gacggctacgatgacttctacgtgtgggacgatggaaagctgaatgaggaaactggtgga
agagatcctccctctaactgggtcagtgtgttcagcggacccatgtggacgtggaacgaa
aagcgccagcagttcttcctgcaccagtttcaggtgaagcaaccggatctaaactttacc
aatccaatggtcagggagcacatgctggatgtcttgaagttttggctggaccgcggagtt
gatggattccgtattgatgcagttccacacatctacgagcaccgcaatgcagacggctcc
tatccggatgaaccggtaagcggctggagtagtgaccccaacgcctacgactaccacgat
cacatctacaccaaggatcagccggccacggtggatctcatgtacgagtggcgggagttt
ttggataactatcgggagcagaatggaggcgattcacgggttctgttggccgaggcctat
tcctccgtggagactctgagtgcttatttcggaaacagcacccatcagggtacccagctg
cccatgaacttccagttgatgtatctcagtggctactcaaccgcagaggacgttgtgggc
tccatcgactactggatgaataccatgtggaaggagcaccaaacggccaactgggtcgtt
ggcaatcacgacacaaacagagttgctgatcgtatgggagctcacgaagtggatctgctc
aatgtgatcgtaaacgccctgccaggtgcttctgtgacctactacggcgaggaaatcggc
atgtccaacgtggacgtggagtgtaccggcgactcttgcgaagatcgcgacggagagcgc
acgccaatgcagtggacggctggaaagaacgccgacttttctgatgggcagtccacctgg
ctacccctaagccccgaatatcagaggtacaatgtgcagacggaacgcggtgtttccaga
tcttcccttaacatcttcaagggtctccaggctcttaagagcagtgccgcctttcttgcg
ttcaaggaggatggcggtttctcctatgaggcggtgacgaaacaggttctacagatcatc
cgcacaaacaagatcagcgaggagtatcgaatcctggttaacatgggcaacgatatggaa
atcctcgatgggctggcctccaaaacctacgagtatgtgctggtcaccgcctactccaca
cactatccggggcaaaaagcatatctgtcggagagaatcattctcatgccctacgaagca
gtcgttttgcgctggttggcttaa

DBGET integrated database retrieval system