KEGG   Drosophila erecta: Dere_GG25325Help
Entry
Dere_GG25325      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
der  Drosophila erecta
Pathway
der04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:der00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dere_GG25325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:der01002]
    Dere_GG25325
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    Dere_GG25325
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dere_GG25325
Peptidases [BR:der01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dere_GG25325
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG25325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Auto_anti-p27
Motif
Other DBs
NCBI-GeneID: 6541249
NCBI-ProteinID: XP_001969268
FlyBase: FBgn0117446
UniProt: B3N7W6
LinkDB All DBs
Position
Unknown
AA seq 269 aa AA seqDB search
MRSSIGLTGMAKTILQLFLGGVLLVNLSLGATVTLRRPRLDGRIVGGQEASIKDIPYQVS
LQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKF
DAYTIDFDFSLLELEDYSATNVTQAFVGLPEQDAEIADGTPVLVSGWGNTQNAQETTAIL
RSVTVPKVSQMQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLTADGVLWGVVSW
GYGCARPNYPGVYSRVSAVRDWIGSVSGI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgagcattggattgaccggcatggcaaagacgattcttcagctgtttctcggc
ggcgttctcctggtaaatcttagcttaggtgccactgtgacactgagacgccctcgcctg
gatggacgcattgtgggcggccaggaggctagcataaaggacattccctatcaggtttcc
ctgcagcgtagttatcacttctgtggtggctccctaatcgctcagggctgggtactcaca
gctgcccactgcaccgaaggatcggccatactcttatccaaggttcgcattggatcctct
cggacttctgtaggcggtcaactggtggggatcaagcgcgtccatcgacatcccaaattt
gatgcctacaccattgactttgacttttcgctgctcgagctggaggattatagtgccacg
aacgtgacacaggctttcgtggggcttcccgagcaggatgcggagattgccgatggtact
ccggtcctggtttccggctggggaaacacgcagaacgcccaggagaccacagccatcctg
cgctccgttacagtgcccaaagtcagtcagatgcagtgcacagaggcttatgggaacttt
ggaagcatcacggatcgcatgctctgcgccggattgccggagggcggcaaggacgcctgc
caaggggactccggaggtcctctcactgctgatggtgtcctttggggcgtggtctcctgg
ggctacggctgtgccaggccaaactatcccggcgtctactcgcgcgtctctgcggttcgt
gactggattggctccgtcagtggcatctga

DBGET integrated database retrieval system