KEGG   Desulfuromonas soudanensis: DSOUD_0809Help
Entry
DSOUD_0809        CDS       T04049                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
des  Desulfuromonas soudanensis
Brite
Enzymes [BR:des01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DSOUD_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALC15596
UniProt: A0A0M4CZS5
LinkDB All DBs
Position
930065..930658
Genome map
AA seq 197 aa AA seqDB search
MTIALPELPFPIAALEPHISARTFEFHHGKHHKAYVDNTNKLIEGTPLAGKDLESIILAA
AGDQAKKGLFNNAAQVWNHSFFWKCLKPGGGGKPTGKVAARIDADLGGYEKFAADFKNAG
ATQFGSGWAWLVLKDGKLEIAQTANAETPLTKGHKPLLVVDVWEHGYYLDYQNRRPDFLQ
AFLDHLVNWDFVNANLG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgccctgcccgaactcccctttcccatagccgctctggaaccccatatcagt
gcgcgcaccttcgagtttcaccacggcaagcaccacaaggcctacgtcgacaacaccaac
aagctgatcgaggggactcccctggccggcaaggacctcgagtcgatcatcctggcggcc
gccggcgaccaggccaagaaggggctgttcaacaacgccgcccaggtctggaaccacagc
ttcttctggaagtgcctgaaacccggagggggcggcaagccgacggggaaggtggccgcc
agaatcgacgccgacctcggcggctacgagaagttcgccgccgatttcaaaaacgccggc
gccacccagttcggcagcggctgggcctggctggtcctcaaggatggcaaactggagatt
gcccagaccgccaacgctgaaaccccgctgaccaaggggcataagccgctgctggtggtc
gatgtctgggaacatggctattacctcgattaccagaaccgtcgtcctgactttcttcag
gccttcctcgaccacctggtcaactgggacttcgtcaacgccaacctcggctga

DBGET integrated database retrieval system