KEGG   Desulfuromonas soudanensis: DSOUD_1591Help
Entry
DSOUD_1591        CDS       T04049                                 

Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
des  Desulfuromonas soudanensis
Pathway
des00250  Alanine, aspartate and glutamate metabolism
des00650  Butanoate metabolism
des01100  Metabolic pathways
des01110  Biosynthesis of secondary metabolites
des01120  Microbial metabolism in diverse environments
des02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:des00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DSOUD_1591
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DSOUD_1591
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DSOUD_1591
   00430 Taurine and hypotaurine metabolism
    DSOUD_1591
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DSOUD_1591
Enzymes [BR:des01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DSOUD_1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: ALC16370
UniProt: A0A0M4DHR6
LinkDB All DBs
Position
1733383..1735062
Genome map
AA seq 559 aa AA seqDB search
MPKHRDVARANLENLYRIFTVPEAPDSTLGEIDEAISRDVAGFLQTHIVALERSLEDIEA
DFFNTAIPEEPTFVSEYTEFVKENLVAQSVHTAAPGFIGHMTSALPYFMLPLSRIMTALN
QNLVKVETSKAFTPMERQVLAMLHRLVYRGGDTFYARWIHDSRHALGAFCSGGTIANVTA
LWVARNRLFAPAGDFRGIAQEGLVRSLKHLGCDGLAVLVSRRGHYSLGKAADLLGLGRDN
LVLIDTDDDNRIDLKLLRAEFLRLQEENIRPLALVGIAGTTETGNVDPLAAMADLAAEFG
CHFHVDAAWGGPTLFSDRHRSLLSGIERADSVTIDAHKQLYVPMGAGMVVFKDPTALSAI
EHHAAYILRHGSKDLGSHTLEGSRPGKAMLVHAGLSIIGRKGYELLIDLGIARAKTFAAM
IRQHPDFELTSVPELNILTYRYCPQAVQQKLVLATSLQRTHLNALLDQVNLLLQKEEREA
GKTFVSRTRLRLAPYGQELTVLRVVLANPLTTDEILASVLEEQCRIVQHPEIRELMLQVD
ALCAEIEDGPTAPACAGAR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagcaccgggacgtggctcgcgccaatctggaaaacctctaccgcattttcacg
gttcccgaggcccccgattcgaccctcggggagatcgatgaggcgatcagcagggacgtc
gccggctttctccagacccacatcgtcgccctcgagcggagcctcgaggatatcgaggcc
gacttcttcaacaccgccatccccgaagagccgaccttcgtctccgagtacaccgagttc
gtcaaggagaacctggtcgcccagtcggtccatacggcggctcccggctttatcggccac
atgacttcggcgctcccctacttcatgctccccctctcaaggatcatgacggccctcaac
cagaatctcgtcaaggtggagacctccaaggccttcacgccgatggagcgccaggtcctc
gccatgctccaccgcctcgtctaccgggggggcgacaccttctacgcccgctggatccac
gacagccggcacgccctcggagccttctgctccggcgggacgatcgccaacgtcacggca
ctgtgggtcgcccgcaaccgcctcttcgcaccggcgggagatttccgcggcatcgcccag
gaagggctggtgcgatccctgaagcacctggggtgcgacggcctcgccgtcctcgtctcc
cggcgggggcactattccctcggcaaggccgccgacctgctcggactcgggcgggacaac
ctggtgctcatcgacaccgacgacgacaaccgcatcgatctcaagcttctgcgggctgag
tttttgcggctgcaggaggaaaacatccgccccctggccctggtcggcatcgccggcacc
accgaaacggggaacgtcgatcccctcgcggccatggccgatctcgccgcggagttcggt
tgtcattttcatgtcgacgccgcctggggggggccgaccctcttctccgaccgccaccgc
tccctcctctcggggatcgaacgggccgactcggtgaccatcgacgcccacaaacagctc
tacgtccccatgggggcgggaatggtcgtcttcaaggaccccacggccctttcggccatc
gagcatcacgccgcctacatcctccgtcacggctccaaggacctggggagccacaccctc
gaagggtcgcggccggggaaggcgatgctcgtccacgccgggctctcgatcatcggccgc
aaggggtacgagctcctcatcgatctggggatcgcccgggccaaaaccttcgccgccatg
atccggcagcaccccgatttcgagctcaccagcgtcccggagctcaacatcctgacctac
cgctactgcccgcaggccgtgcagcagaagctggtcctggcgacgtccctgcagcggacg
cacctcaacgccctgctcgatcaggtcaatctgctgctgcagaaggaggagcgcgaggcc
ggcaagaccttcgtctcccgcacccgtctgcgcctggctccctacggccaggagctcacc
gttttgcgcgtcgttctcgccaaccccctgaccaccgacgagatccttgccagcgtgctc
gaagagcagtgccggatcgtccaacacccggagatccgcgagctgatgctgcaggtcgat
gccctctgcgccgagatcgaggatggtccgaccgctccggcctgcgccggggcgaggtga

DBGET integrated database retrieval system