KEGG   Desulfuromonas soudanensis: DSOUD_1872Help
Entry
DSOUD_1872        CDS       T04049                                 

Gene name
trxB-2
Definition
(GenBank) thioredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
des  Desulfuromonas soudanensis
Brite
KEGG Orthology (KO) [BR:des00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DSOUD_1872 (trxB-2)
Enzymes [BR:des01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DSOUD_1872 (trxB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 YHS K_oxygenase HI0933_like FAD_oxidored GIDA NAD_binding_8 Pyr_redox Thi4 FAD_binding_2 NAD_binding_7 zf-FCS Lycopene_cycl ATPase-cat_bd DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ALC16644
UniProt: A0A0M5IL22
LinkDB All DBs
Position
complement(2021471..2022547)
Genome map
AA seq 358 aa AA seqDB search
MRKDPVCGMPVDQKTPFTAECEGKMFRFCSEGCREKFLSDIICKSTRDSYDLIVIGGGPA
GLTAAVYAATLRIDALLISRDLGGQAIDSTKVENYMGFDFITGPELVDKFRHQLIHSHYI
DHLIAEVEAVEADEEGYRVKTPAAAYRARALLVATGMTRRKLGIPGEEDFQRRGVFYGNI
PDFSQVEGWDVAVIGGGNSALQIVENLQPVAGAIHLISNSELKADQAVIERACRIPSLIR
HEGFQAQVFSGDKHLSGVAIRKRGEEKMVEILVRGVFIAVGLQPNSGLAAPLLELNERGE
IPIGPDCSTSRRGLFAAGDVTDAFGKRIIIAAGEGAKAAIAAREYLLHLKKRKCVTQS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagaccccgtatgcggcatgcccgttgaccagaaaactcctttcaccgccgag
tgcgaaggcaaaatgtttcgattctgctccgaagggtgtcgggaaaaatttctcagcgat
ataatctgcaaatctacccgggattcctacgatctcattgtcatcggcggcggcccagcc
ggactgaccgctgccgtctatgcggcaacgctaaggatagatgccctgctgatcagcagg
gacctgggaggtcaggccatcgacagtaccaaggtcgaaaactatatgggcttcgacttc
atcaccggaccggaactggtcgacaagttccgccaccagttgatccattcccattacatc
gatcatctgatcgctgaggtggaggcggtggaagcggatgaggagggatatcgcgtcaag
acacctgccgccgcctatcgcgcccgagcgttgctcgtcgccactgggatgacgcgaaga
aagctcggcatcccgggcgaagaggacttccagcggcggggcgtcttctatggaaacatt
cccgacttctcccaggttgagggatgggatgttgccgtcatcggcggcggcaactcagcc
ttgcagatcgtcgaaaacctgcagccggtggccggcgcgattcatctgatctccaattcc
gagctcaaggcggatcaggccgtcatcgagcgggcctgccgcattcccagtctgatccgg
catgaaggatttcaggcccaggttttcagcggggataaacacctgtccggcgtcgccatc
cgtaaacgcggggaagaaaagatggtcgaaatcctcgttagaggagtttttatcgctgtt
ggcctgcagcccaactctggacttgccgcccccttgctggagttaaatgaacgcggggag
attcccatcggccccgattgctcgacgtcgcgccggggtctttttgccgccggcgacgtg
accgacgccttcggtaagagaatcatcatcgccgccggcgaaggggcgaaagccgccatc
gctgcaagggaatatcttctgcacctcaaaaagaggaaatgtgtaacccagtcgtga

DBGET integrated database retrieval system