KEGG   Desulfuromonas soudanensis: DSOUD_2965Help
Entry
DSOUD_2965        CDS       T04049                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
des  Desulfuromonas soudanensis
Pathway
des00473  D-Alanine metabolism
des01100  Metabolic pathways
des01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:des00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DSOUD_2965 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DSOUD_2965 (alr)
Enzymes [BR:des01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DSOUD_2965 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:des01011]
 Precursor biosynthesis
  Racemase
   DSOUD_2965 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALC17693
UniProt: A0A0M3QGE8
LinkDB All DBs
Position
complement(3241178..3242347)
Genome map
AA seq 389 aa AA seqDB search
MQVHRPTHVEIDLDALRHNFLLARAQAGEGREVLAVVKADAYGHGAVPVARVLQGAGADL
FGVAIVEEGVELRRAGIHAPILVLGGIYPGQEEDLLRQDLTPCLFDLAVARRLQTAAAAA
GRILPYHLKLDTGMGRVGFRPEELPQVLAELAALPALRMEGVISHLALADEPQHPFTDEQ
VRRFRQALAQIRAAGFAPRYTHIGNSAALFSRVLPECNLVRPGIVLYGGLPAAEFAGRLD
LQPVMSFRTSIAQLKTVPPGTGISYGHRFTTSVPTLLATIPVGYADGYSRHLSCKGEVLV
RGRRAPVVGTVCMDWTLIDVSAIPGVEVGDEVTLLGSDNGNRISAEEWAEKVGSISYEVF
CSVSKRVPRIYKDQSSDLQGPTAEAAPQP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttcaccgtccgacccatgttgaaatcgacctcgacgccctgcgtcacaacttt
ctcctcgcccgggcccaggccggagaagggcgggaggtcctggccgtggtcaaggccgac
gcctacggccacggcgcggtcccggtggcccgggttcttcagggagccggtgccgatctt
ttcggagtcgccatcgtcgaggaaggggtcgaactgcgccgggcgggtatccatgcgccg
atcctcgttctcggcggcatttatcccggacaggaagaggacctgctgcgccaggatctc
accccctgtctcttcgatcttgcggtggctcgccgcctgcagacggcggccgcggcggcc
ggaagaatccttccctaccatctcaagctcgatacggggatggggcgggtcggctttcgc
cccgaggagctcccgcaggtgttggcggaacttgccgccctccccgcgctgaggatggag
ggggtcatctcccacctcgccctggccgacgagccgcagcacccctttaccgacgaacag
gtgcggcgtttccggcaggcgctggcgcagatccgcgccgcaggttttgctccccgctac
acccacatcggcaacagcgccgccctcttttcccgcgtcctccccgaatgcaacctggtc
cgccccgggatcgtcctctacggcgggctccctgcggcggaattcgccggccgcctcgac
ctgcagccggtgatgagctttcgtacctccatcgcccagctcaagaccgtcccgccggga
accgggatctcctacggccaccgcttcaccacctccgtcccgacgctgctggcgacgatt
cccgtcggctatgccgacggttacagccgccacctctcctgcaagggagaggtcctggtc
cgcggccggcgggctcccgtggtcggcaccgtctgcatggactggaccctcatcgacgtc
agcgccatccccggcgtcgaggtcggcgacgaggtcaccctcctcggatccgacaacggc
aaccggatcagcgccgaggagtgggcggaaaaagtggggagcatctcctacgaggtcttc
tgctcggtcagcaagcgggtgccgcgcatctacaaggatcaatcgtccgacctccagggg
ccgaccgccgaggccgctcctcaaccctga

DBGET integrated database retrieval system