KEGG   Desulfuromonas soudanensis: DSOUD_3259
Entry
DSOUD_3259        CDS       T04049                                 

Gene name
tssM
Definition
(GenBank) type VI secretion system ATPase and inner membrane protein TssM
  KO
K11891  type VI secretion system protein ImpL
Organism
des  Desulfuromonas soudanensis
Pathway
des03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:des00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DSOUD_3259 (tssM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:des02044]
    DSOUD_3259 (tssM)
Secretion system [BR:des02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DSOUD_3259 (tssM)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: ALC17979
UniProt: A0A0M3QGH4
LinkDB
Position
complement(3580392..3584063)
AA seq 1223 aa
MKRILNFLRGYLLGRSGSTVVGLFLLLSLVWWGGPSVGLRSGALRLTVMAALVGVAGAIW
LLRLWKVRRSAARFRMELQGEGGSAPERQLEIAELREKMNAAISALKSSGLGVGYRGNAA
LYALPWFMIIGPAAAGKTTLLRNSGLHFPYAHGDDADIKGFGGTRNCDWWFSDEAVILDT
AGRYTTEDDDREEWVAFLDLLRRHRSRVPVNGVMVALSLAELLTCDGAGIEWHVKVIRDR
LDELINHLGCNFPIYLVVTKCDLLHGFTSFFEDLSEHDRSQIWGAWLLDEGENQDLAASF
EKRLQQLQGRLSELRLRRLSMQRKLELKHAIFDFPNQFQVATDKLQEFFNLLVKENPYQE
TPRFCGVYLTSGTQEGTPIQRIVGNLRQAFGYVEDASLDDPGTTKSYFIKKLFQEAIFPN
SGGIVRNRRREVLNRWFKSAWVATGLAVIVGSVLLLSASLASNTLLAGKGSDFVRVMTEE
VVSGDRNQERSFSSILSVYRHYRKLCGYEERLPLHLLLGIYQGEKQLEPTLTALLDSLDL
VFFKPSVTSLEYRLENFARQWDGSDDKGQEKIREPYYQALKTYLMLSMPERLSPEFAAPV
LAETWCELIFRGGAESEFQEEERQDMEEMILLYLAHLKRPMDDPLAVRPWKRRKEIVARS
REQLRTPPNAERLYVQILNKGKLSLKDRKFEEFIKGHGYGVLHSDHVQPGVYTARGWTDF
VQPEIKKVVTVASRGDWVIGYYRDGEGPASGNPAEVATGVTVADSPEGAEPDEGAVNAKL
AMRLEREIRQQYFRDYADAWFSLLESVRYPSFTSVADASKKMLVVAQSDGPIGELMRVIS
NNVNLEDPPESGVGAPLENLAQGAGGFQARRSVPELEETLRDLRKFADPAEKMTVSLLIN
QYLLAISSVQNEMERLGASVDVQREANLYAAKILTGSGGDLELYKSWVSTSSMLNGIEPR
TRKLASGVLIGAIRSAWGAVLSEADQDLQLQWKNSVVSPYERKLQGKFPFASKGSDAALA
DVADFFRPQDGIFWSFVRTNLAPFVSEGRGEWRQKTWLDLGPGFSKELMTSLSRSNVITA
GLFRRGSDEPNLQFYLYPMPSRGLSETMIESNGQSYRYRNEPQEWRKFLWPGNGEGLGAK
IQGVSGRSAARGELNYEGIWGLFHLLQKGKITAESGNQYLGVWELTGSDGAPLTVQFKIK
ADRENNVFDRKVLSGYALPVSLF
NT seq 3672 nt   +upstreamnt  +downstreamnt
atgaaacggatcctgaatttcctccgggggtatcttcttggccgttccggaagtaccgtc
gtcggccttttccttctcctttccctggtgtggtggggcggaccctctgtcggtcttagg
agcggcgcccttcgcctgacggtaatggcggctctcgtcggggtcgccggggcgatctgg
ctgttgcgtctgtggaaggtacggcgcagcgccgcccgattccggatggagttgcagggg
gaggggggtagcgccccggagcgccagctggagatcgccgagcttagggagaagatgaat
gccgccatttcggccctcaagtcgtcgggactcggagtcggttatcgggggaacgcggcc
ctctacgccttgccctggttcatgatcatcggcccagccgccgccggcaagacgaccctt
ttgcgaaattcggggctgcactttccctatgcccatggcgacgacgccgacatcaagggg
ttcggcggcacccgcaactgcgactggtggttttccgacgaggcggtgattctcgatacg
gccggtcgctacaccaccgaagatgacgaccgtgaggagtgggtggccttccttgacctc
ctccgccgccaccgcagccgggtgccggtcaacggggtgatggtggccttgagtctcgcc
gagctcctgacctgcgacggcgccggaatcgaatggcatgtcaaggtaatccgcgaccgt
ctcgacgagctgatcaaccatctcggctgcaacttccccatctacctggtggtgaccaag
tgcgatctcctccacggcttcacttccttcttcgaggatctcagcgagcatgaccgcagt
cagatctggggggcctggctccttgacgagggggaaaatcaggatctggccgccagcttc
gaaaagcggttgcagcagttgcaggggcggctgagcgaactgcggttgcgcaggctatcc
atgcagcgaaagttagaacttaaacatgcgattttcgactttcccaaccagtttcaggtc
gcaacggacaagcttcaggaatttttcaacctcctggtcaaggaaaatccctaccaggaa
accccgcgcttctgcggcgtctatctcaccagcggcacccaggaggggacaccgatccag
cgcatcgtcggcaatctccgtcaggccttcggctatgtggaggatgcctccctcgacgat
ccggggacgacgaagagctatttcatcaagaaactcttccaggaggcgatattccccaat
tccggcgggatcgtccgcaaccgccgccgggaggtcctcaaccgctggttcaagagcgcc
tgggtggccacgggactggcggtcatcgtcggcagcgtcctccttctcagcgcctcgctg
gccagcaacaccctcctggcaggcaaggggagcgattttgtccgggtgatgaccgaggag
gtcgtctccggcgaccgcaaccaggagcgaagcttcagctccatcctcagcgtctatcgc
cattatcgcaaactgtgcggttatgaagagcgcctcccccttcatctcctgctggggatc
taccagggggaaaaacagctcgaaccgaccctcacggccctcctcgattccctcgacctg
gtctttttcaagccgtcggtgacctctctcgaataccggctggagaacttcgcccgccag
tgggacggttccgacgacaaggggcaggagaagattcgcgaaccctactatcaggcgctc
aagacttatctgatgctgtcgatgccggagcggctttcgcccgagttcgccgcgccggtg
cttgcggaaacctggtgcgaactgattttccgggggggagcggaatccgagttccaggaa
gaggagcgccaggatatggaggagatgattcttctttatcttgcccatctcaagcgtccc
atggacgatcctctggcggttcgcccctggaagcggcgaaaggaaatcgttgccaggtcc
cgggaacagctgcggaccccccccaacgccgagcgcctctatgtgcagatcctcaacaag
gggaagctctccctcaaggaccgcaaattcgaagaattcatcaaagggcacggttacggc
gtcctccacagcgaccatgtgcagccaggcgtctataccgcccgggggtggacggatttt
gtccagccggagatcaagaaggtggtgacggtggccagtcgcggcgactgggtgatcggc
tattaccgcgacggcgagggtcccgcttcagggaacccagccgaggtggcgaccggggtg
accgtcgccgattcgccggagggggccgagcccgacgagggggctgtcaatgccaagctg
gcgatgcgcctggagagggaaattcgccagcagtattttcgggactatgccgacgcctgg
ttctcgcttctggagtcggtgcggtacccttccttcacctccgtggccgacgcttccaaa
aagatgctggtcgtcgctcagagcgacgggccgattggcgaactgatgcgggttatctcc
aacaacgtcaacctcgaggatcccccggaatccggtgtcggagcgcccctggaaaacctc
gcccagggagccggaggctttcaagcccgccgcagcgtaccggagctcgaagaaaccctg
cgcgacctgcgcaagttcgccgatccggcggaaaagatgaccgtcagcctccttattaat
cagtaccttctcgccatttcctcggtgcagaacgagatggagcgactgggggcttcggtc
gacgtgcagcgggaggccaacctctatgcggcgaagatcctcaccggctccggcggggat
ctcgagctctacaagagctgggtttcgacctccagcatgctcaacggcatcgagccgcga
acccgtaaacttgcctcgggcgttttgatcggggcgattcgcagcgcctggggggccgtc
ctcagcgaagccgatcaggacctgcagctgcagtggaagaattcggtggtcagtccctac
gagcgcaagctgcagggaaaattcccctttgccagcaaggggtccgatgcggccctggcc
gacgtcgctgatttcttccgaccccaggacggaattttctggtcctttgtccgcaccaat
ctcgccccctttgtcagcgaagggcggggggaatggcggcagaagacctggctcgatctg
ggaccgggcttcagcaaggagctgatgacctccctgtcccgctcaaatgtcatcactgcc
ggtctctttcgccgcggcagcgacgagccgaatctgcagttctacctctatcccatgccg
agccggggcctcagtgaaacgatgatcgagagcaacggtcaatcctaccgctaccgcaac
gaacctcaggagtggcgcaaattcctctggcccggcaacggggaagggctcggggcgaag
atccagggggtgagcggacggagtgcggcgcggggcgagctgaactacgaggggatctgg
ggactcttccatctgttgcagaaggggaaaatcaccgccgagagcggcaaccagtacctc
ggcgtttgggaactcaccggcagcgacggcgccccgctcacggtgcagttcaagatcaag
gcggaccgggagaacaacgtttttgaccgtaaggttctctccgggtatgccctccccgta
tcccttttctga

DBGET integrated database retrieval system