KEGG   Desulfuromonas soudanensis: DSOUD_3393Help
Entry
DSOUD_3393        CDS       T04049                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
des  Desulfuromonas soudanensis
Pathway
des00564  Glycerophospholipid metabolism
des01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:des00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DSOUD_3393
Enzymes [BR:des01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DSOUD_3393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 NAD_binding_8 FAD_oxidored Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALC18112
UniProt: A0A0M4DKM8
LinkDB All DBs
Position
3747548..3749173
Genome map
AA seq 541 aa AA seqDB search
MSIHSPPSPHQRDPSRLTRQRFDALIIGGGINGAGIARDLALRGVRVALVEKEDFASGTS
SASTKLVHGGLRYLERFDFRLVFESCRERRILQTIAPHLVRPLPFFIPVYKGDPRSLLTI
RAGMTLYDLLALFRNTGRHTILSADETLRSEPALQGEGLVGAARYWDCRMDDARLCLENI
LAAAEAGAEVFNYMTLTSLLKRGGKVCGARLRDGIDGQEREVEATVIINATGPWLDRLCA
LDGDDAAKLRTTRGTHILVPRINCGDEALYLTAGRDDRLFFVIPWGELSLIGTTDVDDRR
DPDNLTPTEDDIAYLLGEAKRHLRTPELKRDDIVSSFAGLRPLVAEEESKATRTSREHRL
FTSASGLLSVGGGKYTTYRAVAEEVSSRVMELLGRPRGPSLTGSTPLPGGATGDFRRYLA
TQVPLWRSACDLPRERLEGLADLYGSRTPRLLAMADAEPDLLYPIVAGSPLLALQVAYAV
DFEGARTPEDILRRRTPLALLPGRGLAELPAVAEIMASRLGIDRDRRQEWENSYRKRYLT
P
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccactcccccccttctccccaccagcgcgacccctcgcgcctgacccggcag
cgcttcgacgccctgatcatcggcggcggcatcaacggtgccggcatcgcccgcgacctg
gcgctgcgcggcgtccgtgtcgccctggtggaaaaggaagatttcgcctcgggaacctcc
agcgcctcgaccaagctggtccacggcggcctccgctatctcgaacgcttcgacttccgg
ctggtcttcgagtcctgccgcgagcgccgcatcctgcagaccatcgcccctcacctggtg
cgccccctcccctttttcatccccgtctacaagggggacccccgctccctcctcaccatc
cgcgcggggatgaccctctacgaccttctcgccctctttcgcaacaccggccggcacacc
atcctctcggccgacgaaaccctccgcagcgagccggccctgcagggcgaaggccttgtc
ggagcggcccgctactgggattgccgcatggacgatgcccggctctgcctggaaaacatc
ctggcggcggccgaagccggggccgaggtcttcaactacatgaccctgacctccctgctg
aaaaggggaggaaaggtctgcggagcccggctgcgcgacggcatcgacggccaggaacgg
gaggtcgaggcgaccgtcatcatcaatgccaccggtccctggctcgaccgcctctgtgcc
ctcgatggcgacgacgcggcgaaactgcgcacgacccgcggtacccacatcctcgttccc
cgtatcaattgcggcgacgaggcgctctatctgaccgccggacgggacgaccggctcttt
ttcgtcatcccctggggagagctctccctgatcggcaccaccgatgtcgacgaccgccgg
gatcccgacaacctcacccccacagaggacgacatcgcctatctgctcggggaagccaag
cgccacctgcgcaccccggaactcaagcgcgacgacatcgtctcctccttcgccggactc
cgccccttggtggccgaagaggaatcgaaggcgacgcgcacctcccgggaacatcgcctc
ttcacctctgcctcagggctcctttccgtcggcggcgggaagtacaccacctaccgggcg
gtggccgaggaggtttcctctcgggtcatggagcttctcgggcgcccccggggcccctcc
ctgaccgggagcacccccctccccggcggcgccaccggcgacttccgccggtacctggcg
acccaggtccccctctggagaagcgcctgcgatctcccccgggaacggctggaggggctg
gccgacctctacggatcacgaactccgcggcttctggccatggccgatgccgagccggac
cttctgtaccccatcgtcgccgggtcccccctcctcgccctccaggtggcctatgccgtc
gacttcgaaggggcccggacgcccgaggatatcctccgtcgccgcacacccctggccctc
cttccgggacggggtctggccgaactccctgccgtcgccgaaatcatggcgagccgcctc
ggaatcgaccgggaccgcaggcaggaatgggaaaacagctaccggaagcgctaccttacc
ccctga

DBGET integrated database retrieval system