KEGG   Desulfuromonas soudanensis: DSOUD_3509Help
Entry
DSOUD_3509        CDS       T04049                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
des  Desulfuromonas soudanensis
Pathway
des00620  Pyruvate metabolism
des00680  Methane metabolism
des01100  Metabolic pathways
des01120  Microbial metabolism in diverse environments
des01200  Carbon metabolism
Module
des_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:des00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DSOUD_3509
  09102 Energy metabolism
   00680 Methane metabolism
    DSOUD_3509
Enzymes [BR:des01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DSOUD_3509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ALC18223
UniProt: A0A0M3QGQ7
LinkDB All DBs
Position
3869233..3872019
Genome map
AA seq 928 aa AA seqDB search
MKELFWRAEDQRERLDELTTCEAKRKDLPLRRDVRSLGKVLGEVIREQAGEKVYETEEEL
RRLAISHRELEQGEGGEPLDTDEERRLSGKAVSLIAGMTPAEAYQIVKAFSTYFELTNLA
ETNHRKRRRRALELNPQGGDKPGSMRGTLERLRKAGVDREEILRLLGEVTAVPVFTAHPT
EVARRVVRTKRRRVAGVLEELDRLPLTDAEAADGQEGILAEVTALWQTDEVRRRQPTVAD
EIRMGLEHYPGALIAPLPDLYRDVARALDETYGGVTDPAGLPTLVRFGSWIGGDRDGNPF
VTAEVTREALQKGRETILAAYLASVEELKELLTPSTCRREASPELLRACERYAALLPAVA
AEAEGYPPCEPYRRFLRFVLHRIRRSLREEPQGPEGYGKAGELVVDLELVRESLLTHGGA
HLARRYLDPLLRRLGTFGFHLHTLDIRQHARVHSLALRELGAGAEGSGAGGRGRAASPSE
ETTELLRTLREIAALKTTYPPASIRSYIISGASSEEDVYALVWLMELCGIQVSGEGEDPG
LMPVPLFEYIDDLRRAPEVCRTLWSDPGYAPLLDSWGRRQEVMLGYSDSNKDGGMLTSTW
ETYKAHRALHRVAAECNVRLTLFHGRGGTVGRGGGPTHRSILAQPPGAFTGSLKITEQGE
VINFKYADPALALRNLELMVAASLEALAAPPAVGDDGEAWEETLEELSATAFACYRKQIV
DNPDILPYFEQATPVLEFELAKLGSRPARRRQSRSLDDLRAIPWGFGWIQSRHMIPGWFG
VGHALERYAAGGEERLGRLKEMMGHFPFFRDLMRNVELALTKVDLPLARRYAELVSDAAL
RERVFSMVVEEFRRTRKMILAVSSQKTLLETNPGLAHSLRLRNPYVDPLSLIQIELLRRK
RLGEESDELDYVLAATINGIAAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagctcttttggagggccgaagaccagcgggaacgcctggacgaactgaccacc
tgcgaggcaaagcgcaaggacctgccgctgcgtcgcgacgtgcgctctctcggcaaggtc
ctgggagaggtcatccgcgagcaggcgggagagaaggtctacgagaccgaggaggagctg
cgccgcctggcgatcagccaccgcgagctcgagcagggggaagggggggagcctctcgac
accgacgaagagcggcgcctctccggaaaagccgtctccctcatcgccgggatgaccccg
gcggaggcctaccagatcgtcaaggccttctccacctatttcgagctcaccaacctggcg
gagacaaaccaccgcaaacgccgccgccgcgccctggagctgaacccgcaggggggagac
aagccgggatcgatgcgcggcaccctggagcggctgcgcaaggccggggtcgaccgggag
gagatcctgcgccttctcggggaagtgacggcggtccccgtcttcacggcccatccgacg
gaggtcgcccggcgggtggtgcgcaccaagcggcggcgcgtcgccggcgttctcgaggag
ctcgaccgcctcccccttaccgacgccgaggccgccgacggccaggaggggattctcgcc
gaggtgaccgccctctggcagaccgacgaggtccggcgccgccagccgacggtggccgac
gagatccgcatgggactcgagcactaccccggcgccctcatcgctcctctccccgacctt
taccgggacgtggcccgggccctggacgagacctacggcggcgtcaccgacccggcgggc
ctgccgacgctggtccgctttggctcctggatcggcggcgaccgcgacggcaaccccttc
gtcaccgccgaggtcacccgggaggcgctgcagaagggacgggagacgatcctcgccgcc
tacctcgcctccgtcgaagagctcaaggagcttctgaccccctcgacctgccgccgcgaa
gcctcccccgagcttctccgggcctgcgaacgctacgccgccctcctgccggcggtggcg
gccgaggcggaaggttatcccccctgcgaaccgtaccggcgcttcctgcgcttcgtcctc
caccggatccgccgctccctccgcgaagagccgcagggtcccgaggggtacgggaaggcc
ggcgaactcgtcgtcgatctcgagctggtgcgggagagcctccttacccacggcggcgcc
catctcgcccggcgctacctcgatccgctcctgcgccgcctggggaccttcggcttccat
ctccacaccctcgacatccgccagcatgcccgggttcattccctggcgctgcgggagctc
ggcgccggtgccgaagggagcggcgcgggggggcggggacgggccgcgtccccctccgag
gagaccaccgagctcctgaggacgctgcgagaaatcgccgccctcaagacaacctatccc
cccgcatccatccgcagctacatcatcagcggtgcctcttccgaggaggacgtctacgct
ctggtctggctcatggaactctgcggcatccaggtctcgggggagggtgaagatccgggc
ctgatgccggtccccctcttcgagtacatcgacgatctgcgccgggcgccggaagtctgc
cgcaccctctggagcgatccgggctacgcccccctcctcgactcctgggggcggcgtcag
gaggtgatgctcggctactccgactcgaacaaggacggcgggatgctcaccagcacctgg
gagacctacaaggcccaccgcgccctgcaccgggtggcggccgaatgcaatgtccgcctg
accctctttcacggccgcggcggcaccgtcggccgcggcggcgggccgacccaccgctcc
atcctcgcccagccccccggggcctttaccggctccctgaaaatcaccgagcagggggag
gtgatcaacttcaagtatgccgacccggccctggcccttcgcaaccttgaactcatggtc
gccgcctccctcgaggcccttgccgccccgccggccgtcggcgacgacggggaggcctgg
gaggagaccctcgaggagctctcggcgaccgccttcgcctgctaccgcaagcagatcgtc
gacaatcccgatatcctcccttacttcgagcaggccaccccggtcctcgagttcgagctg
gccaagctcggctcccgtccggcgcgacggaggcagagccgctccctcgacgacctgcga
gccatcccctggggattcggctggatccagagccggcacatgatccccggctggttcgga
gtcggccacgccctggagcgctatgccgcggggggcgaggaacgactggggcggctcaaa
gagatgatgggccacttcccctttttccgcgacctgatgcgcaacgtcgaactggcgctg
accaaggtcgacctccccctggcaaggcgctatgccgaactcgtctccgatgcggccctg
cgggaacgggtcttttccatggtcgtcgaggaattccggcgcacccgcaagatgatcctg
gcagtcagctcccagaagacgctgctggaaacaaacccggggctcgcccattccctgcgg
ctgcgcaatccctatgtcgaccccctgagcctgatccagatcgagctgttgcgccgcaag
cgcctcggggaggagagcgacgagctcgactatgtgctggcggcaaccatcaacggcatc
gccgccgggctgcgcaatacggggtga

DBGET integrated database retrieval system