KEGG   Dehalococcoides mccartyi 195: DET0419Help
Entry
DET0419           CDS       T00223                                 

Definition
(GenBank) amino acid ABC transporter, periplasmic amino acid-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
det  Dehalococcoides mccartyi 195
Brite
KEGG Orthology (KO) [BR:det00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:det02000]
    DET0419
Transporters [BR:det02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    DET0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1
Motif
Other DBs
NCBI-ProteinID: AAW40299
UniProt: Q3Z9D5
LinkDB All DBs
Position
complement(394234..395016)
Genome map
AA seq 260 aa AA seqDB search
MKRLSTILMSLILSGALLFSGCQSSTDDTDDNDDSTAKIQVTVVTDATWPPFEYVNEQTH
AIEGFDIDLMKAIAEKGNLEVTFQNVAWDALLAGLATGQYKVAISSITINAERAEKWLFS
DPYFNAGQMVCVQKNNTTILSHNDLTGKKVAAQTGTTGFIEAQKIEGATVKSYDEIGLAF
QDLMNGQIDAVICDTPVAIDYVNANPDKIKKVGTAFTDEFYGISVAKGQTEILARINQGL
AAVIADGTFDQLVAKWNLNP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcttaagtactatccttatgtcccttatcctgtcgggcgcattgctgttttca
ggctgccaaagctccactgacgacaccgatgacaatgatgacagcactgccaaaatacag
gttacggtagtaaccgatgccacctggccgccttttgagtatgttaatgaacaaactcac
gccatagaaggttttgacatagacctgatgaaagccattgccgaaaagggcaacctggaa
gttactttccagaatgtggcttgggatgctctgctggcaggtctggctaccggccagtac
aaagtagccatttcttcaattaccataaacgccgaacgggctgaaaaatggctcttttca
gacccctatttcaacgccggccagatggtctgtgtacagaaaaacaataccactatcctg
agccataacgacctcaccggtaaaaaggttgcagcccagaccggaaccaccgggtttata
gaagcccagaaaatagagggtgccaccgttaaatcgtacgatgaaatcggcctggctttc
caggaccttatgaacggccagattgacgccgttatctgtgatacccccgttgccatagat
tatgtaaatgccaaccctgacaaaatcaaaaaagtgggcacggctttcactgacgaattt
tacggaatctcggtagccaaaggccaaacagaaatactggccagaattaaccagggtctg
gcagccgtcatagctgacggcacctttgaccaactggtagctaagtggaacttaaatccc
taa

DBGET integrated database retrieval system