KEGG   Dehalococcoides mccartyi 195: DET0629Help
Entry
DET0629           CDS       T00223                                 

Definition
(GenBank) D-ala D-ala ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
det  Dehalococcoides mccartyi 195
Pathway
det01100  Metabolic pathways
det01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:det00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DET0629
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DET0629
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DET0629
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:det01011]
    DET0629
Enzymes [BR:det01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DET0629
Peptidoglycan biosynthesis and degradation proteins [BR:det01011]
 Precursor biosynthesis
  Amino acid ligase
   DET0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C GARS_A CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATP-grasp RimK Response_reg
Motif
Other DBs
NCBI-ProteinID: AAW40049
UniProt: Q3Z8S8
LinkDB All DBs
Position
583767..584783
Genome map
AA seq 338 aa AA seqDB search
MQIGLSYDLKQALNPVSGGPDDALEEYDSPETVEAITNALTQAGHTVYRLGGGKEFLRRV
QEQKLDLVFNIAEGLGNYRSREAQIPGILEMLDIPYTGSDPQTLAVCLDKPLTKKLVADA
GIKTARWQLVTSCEELSAIDWSGFPLPAFLKPACEGSSKGVRFASRAGSAKEIVSMAAEL
LTAYEQPVLIEEFISGEEITVGVIGNIQPKVLGIMRVVPKTKTDYFVYSVEVKRNWRQMV
EYEVPAALPAETLSRIEKATLDAYKVLGCRDLCRMDFRVSPDGIPYFLEVNPLPGLNPVS
GDLPIMASKLGISHAELVLKILDTALARHSLTAANCLP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcagatagggctgtcatacgatcttaaacaggcgttaaatccggttagcggcggccct
gatgatgcgctggaagaatatgactcaccggagacggttgaagctatcactaatgcttta
acccaggccgggcatacggtttaccgcttgggtgggggaaaagagtttttacgcagggta
caggaacaaaaacttgacctggttttcaatattgcggagggtttgggcaattaccgcagc
cgtgaggctcaaattcccggtattttagagatgttagatataccgtacaccggctcagat
ccgcagacactggcggtctgtctggataaacccctgactaagaaactggtagctgatgcc
ggtataaaaactgcccggtggcagttagtcaccagctgcgaagagctttcggctatagac
tggtcagggttccccttgccggcttttcttaagcctgcctgtgagggttctagcaagggt
gtcaggtttgcttcacgcgccggaagtgccaaagaaatagtaagcatggcggcagagctg
cttactgcctatgagcagcctgttttgatagaagaatttataagcggcgaagagattacg
gtaggggttatcggtaatatacagcccaaagttttgggtatcatgcgggttgtccccaaa
accaaaactgattattttgtctactctgtagaggtgaaacgcaactggcggcagatggtg
gagtatgaggtaccggcggctttgcctgctgagactttatcccgcattgaaaaggctacg
ctggatgcgtataaggtgctgggctgccgtgacctgtgccgtatggatttcagggtcagc
cctgacggcataccttattttctggaagtaaaccctttgcccggtctgaaccctgtcagc
ggagatttgccgattatggcatctaaactgggtatcagtcatgctgagttggtgttaaaa
atacttgacactgctctggcccgccacagtctgactgcggcaaactgcctgccttag

DBGET integrated database retrieval system