KEGG   Dehalococcoides mccartyi 195: DET0956Help
Entry
DET0956           CDS       T00223                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
det  Dehalococcoides mccartyi 195
Brite
Enzymes [BR:det01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DET0956 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AAW39745
UniProt: Q3Z7W8
LinkDB All DBs
Position
876927..877505
Genome map
AA seq 192 aa AA seqDB search
MYTAHDYSALLGLEGFSDTLLKNHFTLYQGYVNNTNKLSDTLKTMLAEGKTAAPEYAELK
RRFGFEFDGMRLHEYYFSNLGKSAPLSNTGKLYQALSAEFGSYQLWETDFKATASMRGIG
WVILYKDSQTGRLFNQWINEHETGHLAGITPILVIDIFEHAFMTDYGLKRADYIAAFLKN
INWDEAEKRFQN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagctcatgattattcagccctattaggacttgagggattctccgacacgcta
ctcaaaaatcatttcactttgtatcagggttatgtgaacaacaccaataagctttcagac
acactgaaaactatgctggccgaaggcaaaacggctgctccggagtacgctgaacttaaa
cgccgcttcggatttgagtttgacggaatgcgcctgcatgaatactatttttcaaacctg
ggtaaatccgcccccttatcaaatacaggcaaactttaccaggctctctcagcagagttt
ggcagttaccagctctgggaaactgactttaaagccaccgcttctatgcggggtataggc
tgggtaatactctacaaagactcccaaaccgggcggctgtttaaccaatggataaatgaa
cacgaaaccgggcatttggcaggaataaccccgatactggtgatagacatatttgaacac
gcctttatgacagattacggacttaaacgggcggattatattgctgctttccttaaaaat
ataaattgggacgaagctgaaaaacgatttcagaactag

DBGET integrated database retrieval system