KEGG   Dehalococcoides mccartyi 195: DET1272Help
Entry
DET1272           CDS       T00223                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase, putative
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
det  Dehalococcoides mccartyi 195
Pathway
det00061  Fatty acid biosynthesis
det00780  Biotin metabolism
det01100  Metabolic pathways
det01130  Biosynthesis of antibiotics
det01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:det00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DET1272
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DET1272
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DET1272
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:det01004]
    DET1272
Enzymes [BR:det01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DET1272
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DET1272
Lipid biosynthesis proteins [BR:det01004]
 Fatty acid synthase
  Component type
   DET1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase CCDC158 NTase_sub_bind
Motif
Other DBs
NCBI-ProteinID: AAW39450
UniProt: Q3Z715
LinkDB All DBs
Position
1160518..1161357
Genome map
AA seq 279 aa AA seqDB search
MTQTSYGLLKGKKGIIFGPLNEQSLGWKIALACHREGAELAISNVATALKMGNTAELARI
CGQAPLLVADATSDDELKALFAGLKTSLGEIDFIVHSVGMSANIRKKIPYESTNYIFYNK
GLEISAISLHKIIRYALEAGVLKDNGSIVALSYIGAQRVFSQYNDMNDAKALLEAIARNF
GSRLADRGIRVNTVSQSPTRTSAGSGISNFDAMYEYANLLAPLGNASGEECADYVVTLLS
DLSRKVTMQNLYHDGGFSSVGISEKLLGLLERSQPEAGV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacgtcttacggattgctcaagggtaaaaaaggaattatattcggcccctta
aacgagcaaagtctgggctggaaaatagccctggcctgccaccgcgaaggagctgaactg
gctatttccaacgtagctaccgcccttaaaatgggaaacaccgccgaactggcccgcatt
tgcggccaagccccgctgctggttgcagatgccaccagcgatgatgagctgaaagccctg
tttgccggactaaaaaccagcctgggggagatagattttatagtccattcggtaggtatg
agcgccaatatccgcaagaaaataccgtatgaatctaccaactatattttttataacaaa
gggctggagatttcggccatatccctgcacaaaataatccgttatgcccttgaagccggg
gtattaaaagacaacggcagcatagtggcactgtcttatataggggcacaaagggtattt
tcccagtacaacgacatgaacgatgccaaagccctgctggaagctattgcccgaaatttc
ggttcccgcctggcagaccggggaataagggtaaacaccgtttcccagtcacctacccgc
acctccgccggttcgggaataagcaattttgatgccatgtacgaatacgcaaatctgctt
gcccccttgggcaatgccagcggggaagaatgcgctgattatgtggtaaccctgctttca
gacctcagccgcaaggttaccatgcaaaacctttatcatgacggggggttttccagtgta
ggtatttccgaaaaactgcttggcctgctggaacgcagccagcccgaagcaggtgtataa

DBGET integrated database retrieval system