KEGG   Desulfuromonas sp. DDH964: DBW_0675Help
Entry
DBW_0675          CDS       T04368                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
deu  Desulfuromonas sp. DDH964
Pathway
deu00564  Glycerophospholipid metabolism
deu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:deu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DBW_0675
Enzymes [BR:deu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DBW_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AMV71064
UniProt: A0A143B4Q3
LinkDB All DBs
Position
721827..723443
Genome map
AA seq 538 aa AA seqDB search
MDSLSPQRELAPLSSRRHDVLIIGGGINGAGLARDLALRGIGVLLVEQGDFGSGTSSAST
KLIHGGLRYLERFDLRLVFESCRERRVLQRIAPHLVRPLPFFIPVYAGDSRPLWMVRAGL
TLYDLLALFRNTHAHRMLKPAAGLAAEPALRAEGLRGVAHYWDCSMDDARLCLENVLAAR
AAGAVVHNYLQVTGLLRRQGKICGAHLVDSESGQELEVAARLVVNASGPWLDQVCALEEA
APARLRPTRGTHILVPRLNHGNEALYLTAGQDQRLFFAIPWGRGLSLVGTTDIDFSGDPD
TVAPTEEEIDYLLAEVGRHLRGRAPLRSEVVAAFAGLRPLVAEEATRWASRVSREHRIFT
SSGGMLSIGGGKYTTYRGVAAEVADRVSALLGGGYGRCLTAKVPLPGGATGDFGAYLRRS
LPDLVGRSGLSAAVITRLLNRYGSRAGRLIELLGREPQLAAPVAPGSPLLALEVAFACDE
ELARTPDDVLRRRTPLALEKGRGLAEVEGVAILLAERRGRPESRQGWIEAYRRKYARY
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggactccttgtcgccccagcgtgagctcgcccccctctcttcccgtcgtcatgacgtc
ctgattatcggcggtggtatcaatggcgccggcctcgcccgcgatctcgccttgcgcggc
atcggtgtgctgctggtcgagcagggcgatttcggcagcggaacctccagcgcttccacc
aagctcatccacggcggcctgcgctacctggaacgtttcgatctgcggctcgtcttcgag
tcctgccgcgagcgacgggtattgcagcggattgccccccacctggtgcggccgctgccg
ttcttcatcccggtctatgccggcgattcccggccgttgtggatggttcgagccggtctc
accctctacgacctgctcgccctgtttcgcaatacccacgcccaccgaatgctgaaaccg
gccgccggcctggccgcggagccggcgctgcgcgcggaggggttgcgcggcgtcgcccac
tactgggactgcagcatggacgatgcccggctctgcctggaaaacgtccttgccgcccgg
gcggccggagcggtggtgcacaactacctgcaggtgaccgggctgctgcgtcgccagggg
aaaatctgcggggcacacctggtcgatagcgagagcggccaggaactggaggtggcggcc
cgcctggtggtcaatgccagcggcccctggctcgaccaggtctgcgccctggaggaggca
gcgccggcgcggctgcggccgacccgggggacgcacatcctggtgccacgcctcaatcac
ggcaatgaggcactctacctcaccgccggccaggatcagcggctcttctttgccattccc
tgggggaggggcctgtcgctggtcggaaccaccgatatcgacttttcgggcgatcccgat
acggtggcgccgaccgaggaggagatcgattacctgctggcggaggtcgggcgtcacctg
cgtggccgggcgccgctgcgctccgaggtggtcgccgcctttgccggcctgcgcccgctg
gtggcggaggaagcgacgcgctgggcctcgcgggtttcccgggaacatcggatcttcacc
tcctctggcgggatgctttccatcggtggcggcaagtacaccacctaccggggggtggcg
gcggaggtcgccgaccgggtcagcgctcttctcggtggcggctatgggcgctgcctgacc
gccaaggtccccctccccggcggtgccaccggggatttcggcgcctacctgcgccggtcc
ctgccggacctggtggggcggtcgggcctttccgcagctgtcatcacccgcctgctcaat
cgttatggttcgcgggccgggcgcctgatcgaactgctcggcagggagccgcaactggct
gcgccggtggcgccggggtcgcccctgctggccctggaggtggcttttgcctgtgatgaa
gagctggcgcgaacgccggacgacgttctgcgccgccggacgccgctggcgctggagaaa
gggcgcgggctggccgaagtggagggggttgccatcctgctcgccgagcgtcgcggccga
ccggaaagccggcaggggtggattgaagcttatcggcgtaaatacgcccgttactga

DBGET integrated database retrieval system