KEGG   Desulfuromonas sp. DDH964: DBW_0825Help
Entry
DBW_0825          CDS       T04368                                 

Gene name
cga
Definition
(GenBank) Glucoamylase precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
deu  Desulfuromonas sp. DDH964
Pathway
deu00500  Starch and sucrose metabolism
deu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:deu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DBW_0825 (cga)
Enzymes [BR:deu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DBW_0825 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AMV71208
UniProt: A0A143B4E9
LinkDB All DBs
Position
910096..912513
Genome map
AA seq 805 aa AA seqDB search
MKSLERYAPGWPGIPARWTSSAKSGVGTALGSQSRVWFTLSHGIFNEIYYPRIDQACVRD
CGMIVTAGTDFLSEEKRDADSTVTWLAPGVPAFAVVNRCRQGRYRIEKEILADPHRDAIL
QRTRFIAEQGKIEDYRLHLVLAPHLGNQGGGNNAWLGDYKGLPMLFADQDGIALALACSV
PWLQRSVGFVGVSDGWQDLLAHNRMTWDYTRAKNGNVALAAELDLAVGSGECLIVLGFGS
NCAEAGNRARAALQSGFAAAQADYGKGWQNWQKELLPLDPEGGEQNLYRVSTAVVALHES
GNFPGGLIASLSIPWGFSKGDNDLGGYHLAWPRDLVESAGGLLAAGAAAEVRRVLAFLQA
TQEADGHWAQNMWLDGSPYWNGIQMDETALPVLLVDLARREEALSAEAVARFWPMVRAAV
AYLIRCGPVSMQDRWEEDPGYSPFTIAAEIAALLAAAELAELQQEAAIAGYLRETADVWY
AAIDHWMYVTDTDWCRQFEVAGYYVRIAPVESEDGVSRFQQSIPVKNVAPDQAESPACHL
ISPDALALVRFGLRRADDPRILDTVKVVDALLRTETKQGPVWHRYNGDGYGEHADGAPFD
GTGIGRAWPLLTGERAHFELAAGRESEARRLQVALESFAGAEGLLPEQVWDAPDLAEREL
WFGRPSGSAMPLVWAHAEYLKLLRSLHDGAVFDLPPQTVQRYLVDKTTAGHAVWRFNHKL
RTLPVGRTLRIETLAAAVVHWSQDAWATTADARTRDGGLGIHLADLPTAALPAGTAILFT
LYWPDTGNWEGTDFMIRIEARPDGG
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtcttgaacgttacgccccgggctggccggggatcccggcacgctggacctcc
agcgccaagtcgggggtcggtaccgccctcgggagtcagagccgggtctggttcaccctc
agtcacggcatcttcaatgaaatctattatccgcgtatcgatcaggcctgcgtgcgcgac
tgtgggatgatcgtcaccgccggcaccgacttcctgtcagaagaaaaacgcgacgccgac
tccacggtcacctggctggctccgggtgtcccggcctttgccgtcgtaaatcgctgccgc
caggggcgttaccgcattgaaaaggagattctcgccgacccgcatcgggacgcgatactg
caacggacccgcttcatcgccgagcagggcaagattgaggattatcgcctgcacctggtg
ctggcgccgcacctcggcaaccaggggggcggtaacaacgcctggctcggggactacaag
gggctgccgatgctcttcgccgatcaggacggtatcgcccttgcgctcgcctgctccgtc
ccctggttgcagcgttcggttggctttgtcggggtttcggacggttggcaggacctgctc
gctcacaaccgcatgacctgggactacactcgggccaaaaacggtaatgtcgctctcgct
gccgaactcgatctggctgtcgggagtggcgaatgtctgatcgtcctcggttttggtagc
aactgcgccgaggccggtaatcgtgcccgggccgcgttgcagagtggcttcgcggcggcg
caggcggactatggcaaaggctggcagaactggcaaaaagagctccttcccctcgacccg
gagggaggagagcagaacctctaccgggtcagtaccgccgtggtggccctccatgagtcc
ggtaattttcccggcgggctgattgccagcctatcgatcccctggggcttcagcaagggc
gacaacgacctcggcggctatcacctcgcctggccgcgcgatctggtggagtcggcaggc
gggctgctggcggctggagctgcggccgaggtgcgtcgggtccttgcttttttgcaggcc
acccaggaagcggacggccactgggcgcagaatatgtggcttgacgggtccccctactgg
aatggcatccagatggacgagaccgccctgccggtcctcctggtcgacctggcccggcgc
gaagaggcgttgagcgctgaggcggtggcgcgcttctggccgatggttcgtgccgccgtc
gcctacctgatacgctgcgggccggtcagcatgcaggaccgctgggaggaagaccccggt
tattcgcccttcaccatcgccgcagagatcgccgccctgctggcggcggcggaactggcc
gagctgcagcaggaagcggccattgccggctacctgcgcgagactgccgatgtctggtac
gcggcgatcgatcactggatgtacgtcaccgataccgactggtgccggcaatttgaggtg
gccggttattacgtacgcatcgctccggtcgagagtgaagacggtgtgtcgcgctttcag
cagagcatcccggtcaagaacgtcgctcccgatcaggccgaaagtcctgcctgtcacctg
atcagccccgacgccctggcgctggtccgcttcgggctgcggcgcgctgatgatccgcgc
atcctcgatacggtcaaggtcgtcgatgcgttgctccggaccgagacgaagcagggtccg
gtctggcatcgttataatggcgacggctacggcgagcatgcggacggcgcgcccttcgac
ggaaccggcatcggccgcgcctggccgcttctgaccggcgaacgggcccatttcgaactg
gcggcaggacgcgaatccgaggcccggcggttacaggtggccctggaatcgtttgccggc
gccgaaggcctgcttccggagcaggtctgggacgcgcccgatctggcggagcgcgaactc
tggttcgggcgcccttccggttcggccatgccgctggtctgggcgcacgccgaatacctc
aagctgctgcgctccctgcacgacggggccgttttcgatctgccgccgcagacggtccag
cgctatctggtcgacaaaaccactgccggccatgcggtgtggcgcttcaatcacaagctg
cgcaccctgccggtcgggcggacgctgcgcatcgagacgctggcggctgcggtcgttcac
tggagtcaggacgcctgggcgaccaccgcggatgccaggacccgggatggcgggttgggg
atccatctggccgatttgccgaccgccgccctgccggcgggaacagccatcttgtttacc
ctctactggcctgatacgggaaactgggaagggaccgacttcatgatccggatcgaagcg
cggcctgacggcggttga

DBGET integrated database retrieval system