KEGG   Dehalococcoides mccartyi VS: DhcVS_827Help
Entry
DhcVS_827         CDS       T01136                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dev  Dehalococcoides mccartyi VS
Brite
Enzymes [BR:dev01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DhcVS_827 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACZ61957
UniProt: D2BI07
LinkDB All DBs
Position
770817..771395
Genome map
AA seq 192 aa AA seqDB search
MYTARDYSSLIGLEGFSDTLLRNHFTLYQGYVNNTNKLSDTLKTMLTEGKTATPEYAELK
RRFGFEYNGMRLHEYYFSNLGTSAPLSESNKLYQAISAEFGSYQLWEADFKATAAMRGIG
WVVLYKDSQTGRLFNQWINEHETGHLAGLSPILVIDVFEHAFITDYGLKRADYISAFIKN
TNWAKAEKRFKA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagcccgtgattattcgtccctgataggtctcgaaggattttctgatacactc
cttagaaatcactttaccttatatcagggttatgtaaacaacactaataaactttcagat
accttaaaaactatgctcaccgagggtaaaacagctactccagaatatgccgaactcaaa
cgccgatttgggtttgagtataacggtatgcgtctgcacgagtattatttttctaatctg
ggtacttctgcacccctatccgaatcaaacaaactttaccaggcaatctcagcagagttt
ggcagctaccagctctgggaagcagactttaaggctactgccgcaatgcggggaataggc
tgggtagtactctataaagattcccagacagggcggctttttaaccaatggataaacgaa
catgagaccgggcatctggcaggtttgtctccgatattagtcatagacgtatttgaacat
gcctttattacagattacggtttgaaacgggcggattatatttccgccttcattaagaac
acaaactgggctaaagcggaaaaacgctttaaggcataa

DBGET integrated database retrieval system