KEGG   Dechloromonas sp. HYN0024: HYN24_00630Help
Entry
HYN24_00630       CDS       T05616                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dey  Dechloromonas sp. HYN0024
Pathway
dey00970  Aminoacyl-tRNA biosynthesis
dey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dey00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYN24_00630 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dey03029]
    HYN24_00630 (gatB)
Enzymes [BR:dey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HYN24_00630 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HYN24_00630 (gatB)
Mitochondrial biogenesis [BR:dey03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HYN24_00630 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AXS78672
UniProt: A0A3B7A3C8
LinkDB All DBs
Position
130271..131725
Genome map
AA seq 484 aa AA seqDB search
MNQWEVVIGIETHAQLATVSKIFSGASTAFGAAPNTQACAVDLALPGVLPVLNKKAVECA
IRFGLAIGAEVAQKSVFARKNYFYPDLPKGYQISQMDLPVVVGGNITLQVGQGEKAYEKV
VRLTRAHLEEDAGKSLHEDFQGKSGIDLNRAGTPLLEIVSEPDMRSSDEAVAYAKSLHAL
VQWIGICDGNMQEGSFRCDANVSVRPKGQAEFGTRREIKNLNSFRFLKEAIDFEVQWQIN
EIEEGRKIQQATVLFDPDSGETRMMRSKEDAHDYRYFPDPDLLPLVISSEWIARVQGELP
ELPGQMRERFVSELGLSVYDASALTASQEIAGYFQATVASAGKQNAKPCANWVMVDLAGR
LNKDGKEIAASPVSAAQLAGLIQRIADNTISNNIAKKVFEALWNGEGATADEVIDKQGLK
QITDSGAIESLVDEVLAANPANVAEFKAGKEKAFNALVGQVMKAAKGKANPQQVNDLLKQ
KLAG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtgggaagtagtgatcggcatcgaaacacacgcacaactggcgacggtttcg
aagattttttccggtgcctcgacagccttcggcgcggcacccaacacgcaggcttgcgcg
gttgacctcgccttgcccggtgttttgccggtgctcaacaagaaagcggtcgaatgcgcc
attcgctttggtctggccatcggtgccgaagtggcgcagaaatccgtttttgcccgcaag
aactacttttatcccgatctgcccaagggctaccagattagccagatggacctgccggtc
gtcgtcggcggcaatatcaccttgcaggtaggccaaggcgagaaggcttacgaaaaagtc
gtgcgcctgacccgcgcccacctcgaagaggatgccggcaagtcgctgcacgaggatttt
cagggcaagtcgggtatcgatctcaatcgtgccggtacgccgctcctcgaaatcgtctcc
gagccggacatgcgctcctccgatgaggcggtagcctacgccaagtcgctgcacgcactg
gtgcagtggatcggtatctgcgacggcaacatgcaggaaggctctttccgttgcgatgcc
aacgtttccgtgcgtccgaaagggcaggctgaatttgggacgcggcgcgaaatcaaaaat
ctcaactctttccgctttctcaaggaagccattgatttcgaagtccagtggcagatcaac
gaaatcgaggaaggtcgcaaaattcagcaagccaccgtgctgtttgaccccgatagcggc
gagacgcgcatgatgcgcagcaaggaagatgcgcacgattatcgctatttccccgatcca
gatctgctgccgctggtcatttccagcgaatggattgcccgcgttcagggcgagttgccc
gagttgccaggtcagatgcgcgagcgctttgtcagcgaactgggtctgtcggtctacgac
gccagcgccctgaccgccagtcaggaaattgccggatacttccaagcgaccgtcgccagc
gccggcaaacagaatgccaagccctgtgccaactgggtcatggttgatctcgccgggagg
ctcaacaaggatggcaaggagatcgccgcgtcgcctgtatccgccgcccagttggctggc
ctgatccagcgcatcgccgataacaccatctcgaacaacatcgccaagaaggttttcgag
gccttgtggaacggggagggggcgacggcggacgaggtcatcgacaagcagggactcaag
cagattaccgacagcggtgccatcgagtctctggtggatgaagtactggcggccaatccc
gccaatgtcgccgaattcaaggcgggcaaggaaaaggccttcaatgcgctggttggtcag
gtgatgaaggcagccaagggcaaggccaatccgcagcaggtcaatgacctgctcaagcag
aaactggcgggttga

DBGET integrated database retrieval system