KEGG   Dechloromonas sp. HYN0024: HYN24_02420Help
Entry
HYN24_02420       CDS       T05616                                 

Definition
(GenBank) enoyl-CoA hydratase
Organism
dey  Dechloromonas sp. HYN0024
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AXS78989
UniProt: A0A3B7A372
LinkDB All DBs
Position
complement(485559..486347)
Genome map
AA seq 262 aa AA seqDB search
MSQEEPLVLRSDRADGLTTLTLNRPGQFNSLSKDMLTAIQSELDAIAASDSVRVVVIAGA
GKAFCAGHDLKEMRGNHSKAFMQALFKQCGELMLSITRMPQPVIARVHGIATAAGCQLVS
MCDLAVAADVAKFAVSGINVGLFCSTPAVGLARNLGRKAALEMLLTGEFIDAMEARAKGL
VNRVVPTDALDAEIERLAGSILGKSAVAIRMGKGMFYKQLEMGLGEAYDYAGEVMACNMM
SEDAGEGIDAFMQKRKPEYKGC
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagaagaacctctcgtcctgcgcagcgaccgtgccgacggcctgaccaccctg
accctcaaccgtcccggccagttcaactcgctgtcaaaagacatgctgaccgccatccag
agcgaactcgacgccatcgctgcctcggacagcgtccgtgtcgtcgtcatcgccggagcc
ggcaaggctttttgcgccggccacgatctcaaggaaatgcgtggcaatcacagcaaggcg
ttcatgcaggcgctgttcaagcagtgcggcgaattgatgctcagcattacccgcatgcca
cagccggttatcgcccgtgttcatggcattgccaccgccgccggttgccagctcgtctcg
atgtgtgaccttgccgttgccgccgatgtcgccaagttcgccgtttccggcatcaacgtc
ggtcttttctgctcgaccccggccgttggcctggcccgcaaccttggccgcaaggcggcg
ctcgaaatgctgctcaccggggagttcattgatgccatggaagcccgcgccaaggggctg
gtcaatcgcgtcgtcccgaccgatgcgctggatgccgaaatcgaacgactggccggcagt
atccttggcaagagcgccgtcgccattcgcatgggcaagggcatgttctacaagcagctg
gaaatgggtctgggcgaagcctatgactacgcgggcgaggtgatggcctgcaacatgatg
agcgaagatgccggcgaaggtatcgacgccttcatgcagaagcgcaagcccgagtacaag
ggctgctga

DBGET integrated database retrieval system