Dechloromonas sp. HYN0024: HYN24_04655 Help Entry HYN24_04655       CDS       T05616                                  Name (GenBank) DNA polymerase III subunit chi   KO K02339   DNA polymerase III subunit chi [EC:2.7.7.7] Organism dey  Dechloromonas sp. HYN0024 Pathway dey03030   DNA replication dey03430   Mismatch repair dey03440   Homologous recombination Brite KEGG Orthology (KO) [BR:dey00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     HYN24_04655    03430 Mismatch repair     HYN24_04655    03440 Homologous recombination     HYN24_04655  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dey03032]     HYN24_04655    03400 DNA repair and recombination proteins [BR:dey03400]     HYN24_04655 Enzymes [BR:dey01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      HYN24_04655 DNA replication proteins [BR:dey03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      HYN24_04655 DNA repair and recombination proteins [BR:dey03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      HYN24_04655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_chi Motif Other DBs NCBI-ProteinID:  AXS79378 UniProt:  A0A3B7A5J5 LinkDB All DBs Position complement(960854..961276) Genome browser AA seq 140 aa AA seqDB search MTQVFFYHGAADKIAAACALLSGAYAKKKPMLVYALDNAVASGVDRTLWTHSALSFVPHC RADSPLAAETPILITDNLESIPQDERLMNLSQEIPPGFSRFESLIEVVGQEENDRAAARD RVKFYKDRGYEVRYFDLSDR NT seq 423 nt NT seq  +upstreamnt  +downstreamnt ttgacccaggttttcttctaccatggcgcggcagacaagatcgccgccgcctgcgccttg ctcagcggggcctatgccaagaaaaagccaatgctggtctacgcgctcgataacgccgtc gccagcggtgtcgaccgcacgctatggacgcattctgcactgagttttgtaccgcactgc cgggccgattcaccactcgctgccgaaacgccaatcttgatcaccgacaatctcgagtca atcccacaagacgagcgactgatgaacctgagccaggaaatcccgcccggcttttcacgc ttcgagagcctgatcgaagtcgtcggtcaggaagaaaatgaccgcgccgccgccagggac cgcgtcaagttctacaaggatcgcggttacgaagtccgctacttcgatctcagcgaccgc taa

DBGET integrated database retrieval system