KEGG   Dechloromonas sp. HYN0024: HYN24_08310Help
Entry
HYN24_08310       CDS       T05616                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dey  Dechloromonas sp. HYN0024
Pathway
dey00620  Pyruvate metabolism
dey00680  Methane metabolism
dey01100  Metabolic pathways
dey01120  Microbial metabolism in diverse environments
dey01200  Carbon metabolism
Module
dey_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HYN24_08310
  09102 Energy metabolism
   00680 Methane metabolism
    HYN24_08310
Enzymes [BR:dey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HYN24_08310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXS81473
UniProt: A0A3B7A9E5
LinkDB All DBs
Position
1712003..1714765
Genome map
AA seq 920 aa AA seqDB search
MSYRATDSHKDEPLRDDIRLLGRILGDTVREQEGESVFEIVERVRQTAVRFARDGDPAAR
DDLAALLDPLPRDTTQAVVRAFSYFLQLANIAEDEHHIRRRRAHDLANSPPREGSLIFAL
DSLASANVSPETIADFFAHAVVAPVLTAHPTEVQRQSLIRNHRDLARLLDQRERLQMTPE
EQVENDLGIANSILTLWQSRMLRPVRLKVLDEVKNGITYFKETFFTELPRLYIQATQQLQ
KRYPDTVWALPPFFRVGSWIGGDRDGNPFVTADILREALRLQSAAALNHYLDEVHELGGE
LPLSDLLVKVTPELLALAEHSTDHSPQRADEPYRRALSGIYARLAATARVLDQVEPVRHE
IGNAEPYATPEALRADLKVLNNSLKLNGSANLAGGRLRRLLRGVQVFGFHLAPIDLRQNS
EVHARSVAELLAGAGRCPDYEALSENERIALLTAEIATPRPLYSPYLNYSEETEGELAIF
FAARELRQRYGVAALPNCIISKTDGVSDLLELALLLKESGLLLPGAKPQLNVNIIPLFET
IEDLQKSAATMAGVFAIPAYRELIAGRGNEHEVMLGYSDSNKDGGFLTSGWELYKAEIEL
AAVFKQHSVRLRLFHGRGGSVGRGGGPTYHAILAQPAGAVSGQIRLTEQGEVISTKYGSA
DTGRRNLEVLLAATLEASLTDHENKVEPAEQFHTVMDELSLRAFNAYRGLVYETPGFTTY
FRQSTVVNEIASLNIGSRPASRKASERIEDLRAIPWVFSWAQCRLMLPGWYGFGSAVHGY
LAANPTGMATLRRMVKSWPFFQSLLSNMDMVLAKTDLAIASRYAELVTDADLHQRIFSQI
KAEWALTRQHLLAILEQHDFLADNPMLKRSLQLRSPYMDPLNHLQVELLKRHRAGETDER
VARGIHLSINGVASGLRNSG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaccgcgccaccgacagccacaaagacgaacctctccgcgacgatatccgcctg
cttggccgcatcctcggcgacaccgtgcgcgaacaggagggcgaatcggtattcgaaatc
gtcgagcgcgttcgccagaccgccgtccgttttgcccgcgacggcgaccccgccgcccgc
gacgatctcgccgcactgcttgacccgttaccgcgcgacaccacccaggccgtcgtccgc
gccttcagctactttctgcaactggccaatatcgccgaggatgagcaccacatccgccgc
cgtcgcgcccacgatctggccaattcgccgccgcgtgaaggcagcctgatcttcgctctg
gattcgctggcttcagccaacgtatcgccagaaacgattgccgacttcttcgctcatgcc
gtcgttgcccctgtcctcaccgcccacccgacagaagttcagcgccagagcctgattcgc
aatcaccgcgacctggcccgtctgctcgaccagcgcgaacgcctgcagatgacgcccgag
gagcaggtcgagaacgatctcggcatcgccaattccatcctcaccctgtggcagtcgcgc
atgctccggccggtccgtctcaaggtactcgacgaggtcaagaacggcatcacctatttc
aaggaaaccttcttcactgaactgccgcgcctttacattcaggccacgcagcaattgcag
aaacgttaccccgacaccgtctgggccttgccaccctttttccgcgtcggcagctggatc
ggcggcgaccgcgatggcaaccccttcgtcaccgccgacatcctgcgcgaagccctgcgc
ctgcaatcggccgccgccctcaatcattatcttgatgaagtccacgaactgggtggcgaa
ctgccgctctccgacctcctcgtcaaagtcaccccggaactgctggccctggccgagcat
tcaaccgaccattcgccacaacgcgccgacgaaccctatcgacgcgccttgtccggcatc
tacgcccgcctcgcagcgacggcccgggtgctcgatcaagtcgaaccggtgcgccacgaa
atcggcaacgccgaaccctacgccacgccggaagccctgcgcgccgacctcaaggtgctc
aacaattcgctgaagctcaacggcagtgccaatctggccggtggccgtctgcgccgcttg
ttgcgcggggtgcaggtcttcggcttccacctggcgccaatcgacctgcgccagaactcc
gaagtgcatgcccgtagcgtcgccgaactgcttgctggcgccggtcgctgcccggattac
gaggccctctctgaaaacgagcggatcgccctgctgaccgccgaaatcgccacgccgcgc
ccgctctactcgccctacctgaactattccgaagaaaccgagggcgaactcgccatcttt
tttgccgcccgcgagttgcgccagcgctatggtgttgcagccctgcccaattgcatcatc
tcgaagaccgatggtgtctccgacctgctcgaactggccctccttctcaaggaatccggc
ctcctgctaccgggtgctaaaccgcagctgaacgtcaacatcatccccctcttcgagact
atcgaagatttgcagaagagcgccgcaaccatggccggcgtatttgccatcccggcctac
cgcgaactgattgccggacgcggtaacgaacacgaggtcatgctcggctattcggattcc
aacaaggacggcggcttcctgacctccggctgggaactgtacaaggctgaaatcgaactg
gccgcggttttcaagcagcacagcgttcgcctgcgcctgttccacggccgtggcggctcg
gtcggtcgcggcggcggcccgacctatcacgccatcctcgcccagccggccggggcggta
tcggggcagatccgcctgaccgagcagggcgaagtcatttcgaccaaatacggcagcgcc
gacaccggccgccgcaaccttgaagtgctgctcgccgccacgctcgaagccagcctgacc
gatcacgaaaacaaggtcgagccggccgaacagttccatacggtgatggatgaactgtcg
ctacgcgcctttaacgcctatcgtgggctggtttatgaaacgccgggcttcactacctat
ttccgccagtcgaccgtggtcaatgaaatcgcctcgctcaacatcggcagtcgccccgca
tcgcgcaaggcctcagagcgcatcgaagatctgcgggcgatcccctgggtcttcagctgg
gcacaatgccggctcatgctgcccggctggtacggcttcggttcggccgtccacggctat
ctggcagcgaacccgacaggcatggcaacactgcgccgcatggtcaaatcctggcccttc
ttccagagtctgctgtccaacatggatatggtactggccaagaccgacctcgccatcgcc
tcccgctacgccgaactggtcaccgacgccgatctgcaccaacgcattttcagccagatc
aaggcggaatgggcgctgacccgccagcacctgctggctatcctcgaacagcacgacttc
ctggccgacaaccccatgctcaagcgttcgcttcaactccgctcgccctacatggaccca
ctcaaccaccttcaggttgaactgcttaagcgtcaccgtgccggtgaaaccgacgagcgc
gtcgcccgcggcatccacctgtcgatcaacggggtggcttccggactgcgcaacagcggg
taa

DBGET integrated database retrieval system