KEGG   Dechloromonas sp. HYN0024: HYN24_10040Help
Entry
HYN24_10040       CDS       T05616                                 

Definition
(GenBank) superoxide dismutase family protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dey  Dechloromonas sp. HYN0024
Brite
Enzymes [BR:dey01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HYN24_10040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AXS80331
LinkDB All DBs
Position
complement(2094910..2095428)
Genome map
AA seq 172 aa AA seqDB search
MLLRPAIALSALSVVLLGGCATSMSGPSASADLLARSGSAVNGTVRFIETNGRLRVEATV
AGLAPGEHGFHVHEAGDCSAPDATSAKGHFNPTGKAHGHHAGAERHGGDMPNLIANADGK
ASYTAELSGLSLGGTTGVVGRSVVIHADPDDYKSQPAGNSGKRIACGVIAAR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgctgctacgtcccgctatcgccttgagtgccttgtctgtcgtcctgctcggtggctgt
gccacctcgatgtccggcccttcggccagtgccgatctgctcgcccgttcgggaagcgcg
gtgaacggcacggtccgtttcatcgaaaccaatggtcgtttgcgggtcgaagccaccgtt
gccggactagccccgggcgagcatggcttccatgtgcatgaggcgggtgactgcagtgcg
cccgatgccaccagcgccaagggacatttcaatccgaccggcaaggcccatggccatcac
gccggtgctgagcgtcatgggggtgatatgcctaacctgatcgccaacgccgacggaaag
gccagctacacggccgaactaagcggtttgagcctgggcgggacgaccggtgtggtcggg
cgcagtgtggtgattcatgccgacccggacgactacaagtcgcagccggcgggcaattcg
ggcaagcggattgcctgcggggtcattgctgcccgttga

DBGET integrated database retrieval system