KEGG   Dechloromonas sp. HYN0024: HYN24_11310Help
Entry
HYN24_11310       CDS       T05616                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dey  Dechloromonas sp. HYN0024
Brite
KEGG Orthology (KO) [BR:dey00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dey01001]
    HYN24_11310
Enzymes [BR:dey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HYN24_11310
Protein kinases [BR:dey01001]
 Serine/threonine kinases: Other
  Bacterial family
   HYN24_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr cNMP_binding APH Pkinase_fungal DUF3313
Motif
Other DBs
NCBI-ProteinID: AXS80559
UniProt: A0A3B7A7F7
LinkDB All DBs
Position
complement(2363769..2365136)
Genome map
AA seq 455 aa AA seqDB search
MEKIGKYRVIRELGKGATATVYLCDDPDAGRQVAVKVISFGHDSAAMSRRMRKLFQNEGM
VSKRLNHPNIVRVYEAVVEKDYAYLAMEYVEGFTLEDNCRIDKLLPMHRAISIIFKCCMA
LDAAYRQGIIHRDIKPANIMIAANDEPKIADFGLALNMNKDMDRDSTFIMGVGSPAYMSP
EQIKGYPLNQKTDLYSLGVLMFQLLTGRLPFRANNQATLVYRIINTDAPAVTALNPNLPD
GLNAIMRRALEKDLYSRYRNGAEMAKDLSAVRYQMLDEDQTEKDTQHFETLRGLEFFVEF
ENVEIWEVLRVSVWREVLPNVALIREGERNKYFGIIISGSVEISIDRKALCRLGRSEPVG
EVAFLHPASDQRHATAVTLEPTVFLEVNAAALALSSEELLERMRNALLGRMIKRLREVNR
IAAAQGQPAVRADSAAGPGGPSRPAGGIDLQLAPM
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggagaagattggcaaataccgggtgattcgcgagctgggcaaaggcgctacggcgacc
gtctatctctgcgacgatccggatgccggtcgccaggtagcggtcaaggtcatcagcttc
ggtcacgacagtgccgccatgtcgcgtcgtatgcgcaaactgttccagaacgaggggatg
gtgtccaaacgactcaaccaccccaatatcgttcgtgtctacgaagccgtggtcgaaaag
gattatgcctacctggccatggagtatgtcgaaggcttcacgcttgaggataactgccgg
atcgacaaactgctgcccatgcaccgggccatcagcatcattttcaagtgctgcatggcg
cttgatgcggcgtaccggcagggcatcatccatcgcgacatcaagccggcgaatatcatg
atcgccgccaatgacgagccgaagattgccgacttcgggctggcgctgaacatgaacaag
gacatggaccgcgattcgaccttcatcatgggggttggctcaccggcctacatgtcgccg
gaacagatcaagggctatccgctcaaccagaagaccgacctctattcactcggtgtcctg
atgttccagctgcttaccgggcgcctgccgtttcgtgccaacaaccaggcaacactggtc
tatcgcatcatcaataccgatgcgccagccgtgacggcgcttaacccgaacctgccggat
gggcttaatgccatcatgcggcgggcgctggaaaaggacctctacagccgctaccggaat
ggagcggagatggccaaggatctgtcggcggtgcgctaccagatgcttgacgaggaccag
accgagaaggacacgcagcattttgaaaccttgcgcggacttgagttcttcgtcgagttc
gaaaatgtcgaaatctgggaagtgctgcgcgtctcggtctggcgcgaggtgctgcccaac
gttgcgctgatccgtgaaggtgagcgcaacaagtatttcggtatcatcatcagcggctca
gtcgagatatcgatcgaccgaaaagccttgtgccgcctcgggcgtagcgaaccggtcggg
gaagtcgcctttctccacccggcgagcgaccagcgccatgcgacagcggtcaccctggag
ccgaccgtgttcctcgaagtcaatgcggcggcccttgccctatcctcggaagaactgctc
gaacgcatgcgcaacgccctgttgggacgcatgatcaagcgcctgcgggaggttaaccgg
atcgctgcggcgcaagggcaaccggcggttcgcgccgattcggcggcaggcccgggaggt
ccgtcgcggccggcgggtggcatcgaccttcagctggccccgatgtga

DBGET integrated database retrieval system