KEGG   Dechloromonas sp. HYN0024: HYN24_12955Help
Entry
HYN24_12955       CDS       T05616                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dey  Dechloromonas sp. HYN0024
Brite
KEGG Orthology (KO) [BR:dey00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HYN24_12955
Enzymes [BR:dey01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HYN24_12955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO FAD_oxidored HI0933_like FAD_binding_3 Thi4 NAD_binding_8 AlaDh_PNT_C K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AXS80853
UniProt: A0A3B7A7I0
LinkDB All DBs
Position
2696161..2697714
Genome map
AA seq 517 aa AA seqDB search
MLDNNIKVQLSAYLDKLQYPIELVASLDDSAKAQEMRDLLTDIVALSPKVSLRENGTASL
RPSFAIGLPDETPRISFAGIPMGHEFTSLVLALLQTGGHPPKVDAAVIEQIKALPGTFQF
ETFISLSCHNCPDVVQALNLMAVLSPGVTSTLIDGGMFQGEVERRKIMAVPTIFLNGEEF
GAGRMSIEEIIAKLDTGAAARDAEKISAKAPYDVLIVGGGPAGASAAIYAARKGIRTGLL
AERFGGQVMDTLAIENFISVKATDGPKLVMGLEEHVKDYAVDVMNLQRATQLIPGDLIEI
RLANGASVRSKSVILATGARWREMNVPGEQDYRGKGVAYCPHCDGPLFKGKRVAVIGGGN
SGVEAAIDLAGIVGHVTLLEFDGQLRADAVLQKKLFSLPNVTVIVKALSTEVTGNGEKVN
GLVYQDRETDEVKRIDLNGIFVQIGLLPSTDWLKSVVDLSSRGEIEIDARGQTSVPGVFA
AGDCTTVPYKQIIIAMGAGATASLSAFDHLIRRSAPA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaacaatatcaaggtccagctctcggcctatctcgacaagctgcaatatccg
atcgagctcgtcgcctcgctcgacgacagcgccaaggcacaggaaatgcgcgacttgctg
acagatattgtcgcgttgtcccccaaggtcagcctgcgcgaaaacggcacggcgtccttg
cgcccatccttcgctattggcctgcccgacgaaacgccgcgcatcagctttgccggcatc
ccgatgggccatgaattcacgtccttggtgcttgccctgctgcaaacaggcggccatccg
cccaaagtcgatgccgccgtgatcgagcagatcaaggcattgcccggcacattccaattc
gaaaccttcatctcgctgtcctgccacaactgtccggacgtcgtgcaggcgctcaacctg
atggccgtgctcagccccggcgtgaccagcacgctgatcgacggcggcatgttccagggc
gaagtcgagcgccgcaagatcatggcggtgccgaccatcttcctgaatggtgaagagttt
ggtgccggccgcatgagcatcgaggaaatcatcgccaagctcgacaccggagccgcagca
cgggatgccgaaaagatcagcgccaaggcaccctacgacgtactcatcgtcggcggcggc
ccggccggtgcctcggccgccatctatgccgcccgcaagggcatccgcacaggcctcctg
gccgagcgtttcggcggccaagtgatggatacgctggccattgagaatttcatttccgtc
aaggccactgatggcccgaagctggtcatgggccttgaagagcacgtcaaggactacgcc
gtcgacgtcatgaacctgcaacgcgcgacacaattgatccccggtgacctcatcgaaatc
aggctagcaaacggtgcttcggtaaggagcaaatctgtcatcctcgccacgggtgcccgc
tggcgtgaaatgaacgtcccaggcgaacaggattaccggggcaagggggtcgcctactgc
ccccactgcgacggccctctattcaagggcaagcgcgttgcggtgatcggcggcggcaac
tctggcgtcgaggccgccattgatctggccggcatcgtcggccacgtcaccctgctcgaa
ttcgacggccagttgcgcgccgatgcagttttgcagaaaaagctgttcagcctgcccaac
gtcacggtcatcgtcaaagccctgtcaaccgaagtcaccggcaatggcgaaaaggtcaac
gggctggtttaccaggaccgcgaaaccgacgaggtgaaacgcatcgacctcaacggcatc
ttcgtccagatcggtctgctgcccagcaccgactggctgaagtccgtggtcgacctgtcc
agccgcggcgaaatcgagatcgacgccaggggccagacctcagtccccggcgtcttcgcg
gcaggcgactgcaccaccgtaccctacaagcagatcatcatcgccatgggcgccggagcc
actgcctcgctgagcgcctttgatcacctcatccggcggtcggcgccggcctga

DBGET integrated database retrieval system