KEGG   Dechloromonas sp. HYN0024: HYN24_14090Help
Entry
HYN24_14090       CDS       T05616                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dey  Dechloromonas sp. HYN0024
Pathway
dey00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HYN24_14090 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dey02000]
    HYN24_14090 (gstA)
Enzymes [BR:dey01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HYN24_14090 (gstA)
Transporters [BR:dey02000]
 Other Transporters
  Pores ion channels [TC:1]
   HYN24_14090 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N_3 GST_N_2 GST_N GST_C_2
Motif
Other DBs
NCBI-ProteinID: AXS81569
UniProt: A0A3B7AA48
LinkDB All DBs
Position
complement(2935579..2936184)
Genome map
AA seq 201 aa AA seqDB search
MKLYYATGACSLSPHIVLCELGLPHDLVKVELSTHLTATGEDFTAINPKGYVPALQLDDG
QLLTEGPAIVQYLADLKPAAGLLPPAGTLERARVQEWLTFIGTELHKNFSPLFNPAASVD
WKAAALANIERRFGFVEKALAGRDYLTGRAFCVADAYLFTVVNWTRFVKIDLAPWPTLAA
FHQRVLARPGVQAAMKAEGLV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ataaagctttattacgccactggcgcctgttccctgtcaccgcacatcgtgctgtgcgaa
cttggcttgccgcatgacctggtcaaggtcgaactgtctacccatctcactgcgaccggc
gaggatttcacggcgatcaatcccaagggctacgtgccggccctgcaactcgacgacggc
cagttgctcaccgaaggcccggccatcgtccagtacctggccgacctgaagccggctgcc
ggcctgctgccgcccgccggtacgctggagcgggctcgcgtgcaggaatggctgaccttc
attggcaccgaactgcacaagaatttcagtccgctgttcaatccggctgcctcggtcgac
tggaaagcggcggcgctggccaatatcgaacggcgtttcggctttgtcgagaaggcgctg
gccgggcgtgactacctgaccggccgggctttctgcgtggccgatgcgtatctgttcacg
gtggtgaactggacgcgctttgtcaaaatcgatctcgccccgtggccgacgctggcggct
ttccatcagcgggtgctggcgcggccgggggtgcaggcagcgatgaaggcagaggggctg
gtttag

DBGET integrated database retrieval system