KEGG   Dechloromonas sp. HYN0024: HYN24_14275Help
Entry
HYN24_14275       CDS       T05616                                 

Definition
(GenBank) phenol hydroxylase
  KO
K16249  phenol/toluene 2-monooxygenase (NADH) P0/A0
Organism
dey  Dechloromonas sp. HYN0024
Pathway
dey00361  Chlorocyclohexane and chlorobenzene degradation
dey00362  Benzoate degradation
dey00623  Toluene degradation
dey01100  Metabolic pathways
dey01120  Microbial metabolism in diverse environments
dey01220  Degradation of aromatic compounds
Module
dey_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:dey00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HYN24_14275
   00361 Chlorocyclohexane and chlorobenzene degradation
    HYN24_14275
   00623 Toluene degradation
    HYN24_14275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phenol_hyd_sub
Motif
Other DBs
NCBI-ProteinID: AXS81090
UniProt: A0A3B7A873
LinkDB All DBs
Position
complement(2970148..2970423)
Genome map
AA seq 91 aa AA seqDB search
MVQQETNRSATNLGAIRRYVRVCRQRSDGFIEFEFAIGDPELAVELMLPEAAFHEFCLTN
EVIVLDPMEPDSGDWASRLNAISRRDISDAV
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacaggaaacaaatcggtcagccacgaacctcggcgccatcaggcgctacgtc
cgtgtatgccgtcagcgctcggatggcttcatcgagttcgagttcgcgattggtgatccg
gagctggctgtcgaactgatgcttcccgaagcggctttccacgagttttgcctgaccaac
gaagtcatcgttcttgatcccatggagcccgattcgggtgactgggcgtcgcgcctgaac
gctatttcgcggcgggatatttcagacgctgtttga

DBGET integrated database retrieval system