KEGG   Deinococcus irradiatisoli: DKM44_01970Help
Entry
DKM44_01970       CDS       T05530                                 

Definition
(GenBank) hypothetical protein
Organism
dez  Deinococcus irradiatisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-ProteinID: AWN22154
UniProt: A0A2Z3JLL4
LinkDB All DBs
Position
complement(379071..379985)
Genome map
AA seq 304 aa AA seqDB search
MAFSLPSPKLIRPAAFLLLGALALSACGSLDSALPQPATLPSAGTPGASATPKPTPPAPV
TPPVATPVPSPTPAPQPKPAPTPAPAPTPVPAPTPSPTPTPAPTPAPTPSPTPTPAPAPA
PTPTPAPAPAPTPTPAPTPTPAPAPTPAPTPTPAPAPAPAPAPAPASSTFAAEVLRLVNV
ARAQGGSCGGVAYAPSAPLTWNALLAASAQAHAEDMAAHNYFSHTSLDGRTFDQRITATG
YLWRSVAENIAAGQQTPAEVMTGWIASTGHCKNIFNPVLKELGVGYATGGTYGKYWVQDF
GTPR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcctttagcctgccttcacctaaacttatccgtccggcggccttcctcctactgggc
gctttggccctgagcgcctgcggctcgctcgactcggccctgccgcagcccgccacgctt
cccagtgccggcactcccggcgccagcgctacgccgaagccaaccccacccgcgccggtc
acgcctccggtggcgacgccggtgccttcgcccaccccagcacctcagcccaagcccgct
ccaacgccggcccctgctcctacaccggtaccggcgccaaccccttcacccacacctact
cccgcgcccacacctgcccccactccttcaccgacccccacccctgcgcctgcaccagct
cccacccctaccccagcgcccgctccggcacctacgccgacccctgcccctacccctact
ccggcccctgccccgacgcctgcacccactccaactccggcacctgcacctgcaccggct
cctgctcccgcgccggcaagcagcacgttcgctgccgaagtgctgcggctggtgaatgtg
gcccgcgcgcagggcggcagctgcggcggtgtggcctacgcgccctcggctccgctgacc
tggaacgccctgctggctgcctcggcccaggcgcacgccgaggacatggccgctcacaac
tacttcagccacaccagcctggacgggcgcaccttcgatcagcgcatcaccgccaccggc
tacctgtggcgctcggtggccgagaacatcgccgccgggcagcagacgcccgccgaggtc
atgaccggctggattgccagcaccggccactgcaagaacatcttcaaccctgttctcaag
gaactcggcgtgggttacgccaccggcggcacctacggcaagtactgggtgcaggacttc
ggcacgcccaggtaa

DBGET integrated database retrieval system