KEGG   Deinococcus irradiatisoli: DKM44_02065Help
Entry
DKM44_02065       CDS       T05530                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
dez  Deinococcus irradiatisoli
Pathway
dez00500  Starch and sucrose metabolism
dez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DKM44_02065
Enzymes [BR:dez01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DKM44_02065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Pec_lyase SQHop_cyclase_C
Motif
Other DBs
NCBI-ProteinID: AWN22167
LinkDB All DBs
Position
complement(398559..400862)
Genome map
AA seq 767 aa AA seqDB search
MSSPIRFAPGAPGLAPTWTSSDKDAVTTSLGRGRVWASVGHGNLNEIYWPTNGDPQVRDL
SFLIRTPQGWFDLKRTSRYRLMLPPEGPAIGIRHRGPGFTLNLDVVPDPQRDSLLIAYRL
SGDAQLYALLAPHLGDSGEHNTAWVEDEALFARRGENVLTLLASGGFTRASAGFVGVSDG
WQDFNRHGEMTWTYDRAEDGNVALLGELQDKAGVLALAFANRSESALLHARSSVHLEFSS
VRGRFLSGWQTWTESLKLPAGNRRELQQARLSAQVIRVHEGRDFPGGIIASLSVPFGQSH
SDGGGYHLVWPRDMVEGASALLAAGQHEAAQRALQYLLATQGQEGCWPQNIFPDGETYWT
GEQLDETAFAVLLAAKMREQAALGDVRAVSLARGMQRAAAYLVQHGPLSQEDRWEENSGV
SAYTLATIIAALVGAAPWLSVQERAYALALADDWNDRLDGWCYVSGEDAPLAERYGVPGY
YIRIAPQATERPGQQDVTVANTGGLTVKAGALISLDFGYLVRLGLRDARDPRIQHTLRVV
DGELRYDSPGGPVYYRYPHDGYGNKEDGGGFDGQGIGRPWPLLSGERGHLALLSGESPAP
YLNAMLESCGPGGLFPEQIWDKAALPDHGFFPGKPAGSAMPLMWAHAEFIKLLWAREHGA
PFECLQAVHERYAAGGPKPTTRFWRTNSPVNRLPKGMDLLIEDARPFTLHLGHDQWQNVR
DLPAQALPFGRWGVRLRASALRGQRSVEFTRLFAEGWEGRDHQVRLG
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcccgattcgtttcgcgcccggtgcaccgggactggcgcccacctggacgtcc
agcgacaaagacgccgtgaccacctcgctgggccgtggacgggtgtgggccagcgtgggt
cacggcaacctcaacgagatctactggcccaccaacggcgatccgcaggtacgcgacctg
agctttctgatccgcaccccgcaaggctggttcgacctcaaacgcaccagccgctaccgc
ctgatgctgcctccagaaggaccggccatcggcatccgccaccgtgggccgggctttacc
ctcaacctcgacgtggtgccggacccgcagcgcgattcgctgctgatcgcttaccgcctc
agcggcgacgcccagctctacgccctgctggcgccgcacctgggtgactcgggcgaacac
aacaccgcctgggtggaggacgaagcgctgttcgcccgccggggcgagaacgtgctgacc
ctgctcgccagcggcgggttcacgcgggccagcgccggcttcgtcggcgtcagcgacggc
tggcaggatttcaaccgccacggcgagatgacctggacctacgaccgcgccgaggacggc
aacgtggccctgctcggcgaactgcaagacaaagccggcgtgctggccctggcttttgcc
aaccgttccgaatcggccctgctgcatgcccgctccagcgtgcatctggagttctcgtcg
gtgcgcgggcgctttttgagcggctggcagacctggaccgagagcctgaagctgccggcc
ggcaaccgccgcgagcttcagcaggcccgcctcagcgcccaggtgatccgggtgcacgag
ggacgcgattttcccggcggcatcatcgccagcctcagcgtgccgttcggtcagtctcac
agcgacggaggcggttaccatctggtgtggccgcgcgacatggtggaaggcgccagcgcg
ctgctggccgccggacagcacgaagccgcccagcgtgccctgcaatacctgctcgccacc
cagggccaggagggctgctggccgcagaacatctttcccgacggcgagacctactggacc
ggcgaacagctcgacgaaacggcctttgccgtcctgctggctgccaagatgcgcgagcag
gcagcgctcggcgacgtgcgggctgtatcgctggcacgcggcatgcagcgcgccgccgct
tacctcgtccagcacggcccgctcagccaggaagatcgctgggaagagaacagcggcgtg
agcgcctataccctggccaccatcatcgccgcgctggtcggcgccgcgccctggctcagc
gtccaggagcgcgcctacgccctggcactggccgacgactggaacgaccggctcgacggc
tggtgctatgtcagcggcgaagatgcgccgctggccgaacgctacggggtgccgggctac
tacatccgcatcgcgccgcaggccaccgagcggccaggacagcaggacgttaccgtcgcc
aataccggcggcctcacggtcaaggccggagcgctgatcagcctggatttcggctacctg
gtccggctgggcctgcgcgacgcccgcgacccgcgcattcagcacaccctgcgggtggtg
gacggcgaactgcgctacgactcgcccggcggcccggtgtactaccgctacccgcatgac
ggctacggcaacaaagaggacggcggcggtttcgacggtcaggggatcggccggccctgg
ccgctgctctccggagaacgcggccacctggcgctgctgtccggcgagtcgcccgcgccg
tatctcaacgccatgctcgaatcctgcggccccggcgggctctttcccgaacagatctgg
gacaaggccgccctgccggaccacggcttctttcccggcaagccggccggcagcgccatg
ccgctgatgtgggcccacgccgaatttatcaagttgctgtgggcccgagaacacggcgca
ccgttcgagtgtctccaggcagtccacgaacgctacgcggcgggcggtccgaagcccacc
acccgcttctggcgcaccaacagccccgtgaatcgtctgcccaaaggaatggacctactc
atcgaagacgcccggcccttcaccttgcacctgggccacgatcagtggcaaaacgtccgc
gaccttccggcccaggccctaccgttcgggaggtggggggtgcggctgcgggccagtgcg
ctgaggggccagcggagtgtggagttcacccgtctgtttgccgagggctgggagggccgc
gaccatcaggtgcgtttggggtaa

DBGET integrated database retrieval system