KEGG   Deinococcus irradiatisoli: DKM44_09525Help
Entry
DKM44_09525       CDS       T05530                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dez  Deinococcus irradiatisoli
Pathway
dez00620  Pyruvate metabolism
dez00680  Methane metabolism
dez01100  Metabolic pathways
dez01120  Microbial metabolism in diverse environments
dez01200  Carbon metabolism
Module
dez_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DKM44_09525
  09102 Energy metabolism
   00680 Methane metabolism
    DKM44_09525
Enzymes [BR:dez01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DKM44_09525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Peptidase_C70
Motif
Other DBs
NCBI-ProteinID: AWN23439
UniProt: A0A2Z3JKJ7
LinkDB All DBs
Position
1914506..1916995
Genome map
AA seq 829 aa AA seqDB search
MGIREDVNLLGRTLGQVLREQEGEDFYNLVEEVRSLVRRARGGEGSGELQRLIAGLGTDD
AENLVRAFTWYFQLVNLAEEYERVRVLSDTKGVRSQSLEKALIELRERGLSAEQVEALIA
RLDLGLTFTAHPTEMRRRTVRNHLVEVAGSIPDLGHPDLTEEATLRVAAHIEAMWSTPEL
RRLKPTVQDEVKGGLSYLPVIAQALPRLQRDLERAFVHVYGRHSQARLPLSFSSWMGGDR
DGNPFVTPEATRETLDLHRERARELLLAQIQQAYADLSQDGGGEEPYRQTLRALHNAVRD
GDKVDLLGTLEALDRRLREDGQIRSADQLLTPLLTVARTFGQHLVSLDIREHSQLTGAAV
ATLLKAAGVSENYAELPEHSKLDVLSAELNSRRPLWPAGEAFPDELERAVGPIREVQRAV
AAVGPRAFGRYIISMSESVSDILEPLLLAREVGFRILPVPLFETLSDLERAPSVMWELLA
LPEYRRVLGSDVQEIMLGYSDSNKDAGFLAANWALHEAQRKVSAVCQQAGVPWRFFHGRG
TSIGRGGGPASRAILGQPAGTIDAGLRITEQGEALADKYSHPVLAHRNLEQALYGLLLSA
SRPPGELPDRWTQALTQASNISVQTYRALVEDEHFLPFFEAVTPIHEISRLNIASRPVRR
PGAPTLSNLRAIPWVMSWTQNRANLPGWYGLPEALETVGLEAAQEMYREWPFFRSVLDNA
QMALAKSDPQIFDDYLTLGGAGTELARRLQRAYTEAVRCVEAVIGGELLLSEPRLKQSIA
LRNPYIDPIHRIQVELLRRARAEERGLDTYERPLLLSVQGIAAGVRNTG
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgggcattcgtgaagacgtgaatctgctggggcgcacgctgggacaggtgctgcgtgaa
caggaaggcgaggatttttacaacctggtcgaggaagtgcgctcgctggtccggcgggcc
cgcggcggcgagggctccggcgagttgcagcgcctcatcgccgggctgggcaccgacgac
gccgagaacctggtgcgggcctttacctggtacttccagctggtcaatctggccgaggag
tacgagcgggtgcgggtactctccgacaccaagggcgtgcgctcgcagagcctggaaaag
gccctgatcgaactgagggaacggggcctgagcgccgagcaggtcgaggcgctgatcgcc
cggctcgacctgggcctgacctttaccgcccaccccaccgagatgcggcggcgcaccgtg
cgcaaccacctggtggaagtggccggcagcattcccgacctcggccaccccgacctcacc
gaggaagccaccctgcgcgtggcggcgcacatcgaagcgatgtggtcgacccccgagctg
cgccgcctgaaacccaccgtgcaagacgaggtcaagggcggcctgagctacctgccggtg
atcgcccaggcgctgccgaggttgcagcgcgatctggaacgggccttcgtgcacgtctac
ggccggcacagccaagcccgcttgccgctgagcttcagctcgtggatgggcggcgaccgc
gacggcaatccattcgtgacgcccgaggccacccgcgaaacgctggacctgcaccgcgag
cgcgcccgtgagctgctgctggcgcagattcagcaggcctacgccgacctcagccaggac
ggcggcggcgaggaaccctaccgccagacgctccgggcgctgcacaacgcggtgcgtgat
ggcgacaaggtggacctgctgggaaccctggaagcgctcgaccggcggctgcgcgaagac
gggcagattcgcagcgccgaccagctgctcaccccgctgctgacggtggcgcgcaccttc
gggcagcatctggtgagcctggatatccgcgagcacagccagctgaccggcgcggcggtg
gcgacgctgcttaaggccgccggggtctcggagaactacgccgagctgccggaacacagc
aagctcgacgtgctgagcgccgagctgaattcgcgccgcccgctgtggcccgccggcgaa
gcctttcccgacgagctggagcgcgccgtggggccgatccgcgaagtgcagcgggcagtg
gcggcggtcgggccgcgggccttcgggcgctacatcatcagcatgagcgagtcggtcagc
gacattctcgaaccgctgctgctggcccgcgaggtgggcttccggattttgccggtgccg
ctctttgaaacgctcagcgatctggagcgcgctcccagcgtgatgtgggaactgctggcg
ctgcccgagtaccgccgggtgctgggcagcgacgtgcaggagatcatgctgggctactcg
gattccaacaaggacgccggttttctggcggccaactgggccctgcacgaagcgcagcgc
aaggtgagcgcggtgtgtcagcaggccggcgtgccgtggcgcttttttcacgggcgcggc
accagcatcgggcgcggcggcggcccggcctcgcgggccatcctgggtcagccggccggc
accatcgacgccgggctgcgcatcaccgagcagggcgaagcgctggccgacaagtacagc
cacccggtgctggcccaccgcaacctggaacaggcgctctacggcctgctgctctcggca
tcccggccccccggcgagttgccggaccgctggacgcaggcgctgacccaggccagcaac
atcagcgtccagacttaccgcgccctggtggaagacgagcactttctgccgtttttcgaa
gcggtcaccccgattcacgaaatctcgcgcctgaacatcgcctcgcgcccggtgcggcgg
cccggcgcgccgacgctgagcaacctgcgcgccattccctgggtgatgagctggacacaa
aaccgagccaacctgccgggctggtacggtctgccggaagcgctggaaacggtgggcctg
gaagcggcccaggagatgtaccgcgagtggccgtttttccgcagcgtgctcgacaacgcg
cagatggcgcttgccaagagcgatccgcagattttcgacgattacctcaccctcggcggc
gcgggcaccgagctggcccgccgcttgcagcgcgcctacaccgaggcggtccggtgcgtc
gaggcggtgatcggcggcgaactgctgctgagcgagccgcgcctgaagcagagcatcgcc
ctgcgtaacccctatatcgacccgattcaccgcattcaggtggaactgctgcgccgcgcc
cgcgccgaggaacgcggcctggacacctacgagcgcccgttgctgctgagcgtgcagggc
atcgcggcaggggtacgcaacaccggctga

DBGET integrated database retrieval system