KEGG   Deinococcus irradiatisoli: DKM44_14705Help
Entry
DKM44_14705       CDS       T05530                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dez  Deinococcus irradiatisoli
Pathway
dez00564  Glycerophospholipid metabolism
dez01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dez00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DKM44_14705
Enzymes [BR:dez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DKM44_14705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA NAD_binding_8 HI0933_like Pyr_redox_2 Pyr_redox_3 Thi4 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AWN24322
UniProt: A0A2Z3JH45
LinkDB All DBs
Position
complement(2983938..2985503)
Genome map
AA seq 521 aa AA seqDB search
MTDTALPDRRADLLRTASQDLLWDVLVIGGGASGLGAAVEAATRGYKTLLLEAHDYAKGT
SSRSTKLVHGGVRYLAQGNVSLVREALHERGLLKKNAPHLVRDLGFLIASYTWWSKPFYG
IGLKVYDALAGKLNLRPSRLIERQKAFKLVPTLKPEGLKGGVLYFDGQFDDSRLAITLLR
TLEDHGGVALNYAPVVGLSKTGGKVSGATFRDGETGREYTVRAKAVINATGVFVDSVRQL
DDPAAKPMLSPSQGVHVVVDRRFLPGDSALMVPRTDDGRVLFAVPWHDHVVIGTTDTPVP
DVSLEPRPLPEEIDFILQTAAQYLTPAPTRADVRSVYVGLRPLVKAAEGTDTKAISRDHV
IRISESGLLTLTGGKWTTYRRMGEDAVNRAADLADLPARLTLTPGLHLHGWSEAEREDHW
KVYGSDAPKIQALEGAGTRLHPRLPYSEAEVRWAVRMEQARTVEDVLSRRLRALLLGAQA
SIEAAPRVAQLLAEELGKDAAWQAEQVQGYRDLAAGYLLPG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataccgctttgcctgaccgccgcgctgacctactccgaacggccagccaggac
cttctctgggacgtgctggtgatcggcggcggcgcctcgggcctcggcgcggcggtggaa
gcggccacgcgcggctacaagaccctgctgctcgaagcccacgactacgccaaaggcacc
tccagccgcagcaccaagctggtgcacggcggggtgcgttatctggcgcagggcaacgtc
tcgctagtgcgcgaagcgctgcacgaacgcggcctgctgaaaaagaacgcgccgcatctg
gtgcgcgacctgggctttctgatcgcttcttacacctggtggtccaagcccttttacggc
atcgggctcaaggtctacgacgcgctggccggcaagctcaatctgcgtcccagccgcttg
atcgagcgccagaaggccttcaagctggtgccgaccctcaaaccggaagggctcaagggt
ggggtgctgtacttcgacggccagttcgacgattcgcgtctggcaatcaccttgctgcgc
accctcgaggaccacggcggcgtggcgctcaactacgccccggtggtgggcctgagcaag
acgggcggaaaagtgtccggcgcgacctttcgcgacggggagaccggccgggagtatacg
gtgcgcgccaaagcggtgatcaacgccaccggggtgttcgtggacagcgtgcgccagctc
gacgacccggccgccaaaccgatgctctcgccgagccagggcgtgcacgtggtggtcgac
cgccgcttcctgccgggcgacagcgccctgatggtgccgcgcaccgacgacgggcgggtg
ctgttcgccgtgccctggcacgaccatgtggtgatcggcaccaccgataccccggtgccg
gacgtgagcctggagccgcgccccctgccggaggaaatcgacttcatcctgcagacggcg
gcgcagtacctcaccccagcgcccacccgcgccgacgtgcgcagcgtgtacgtggggctc
aggccgctggtcaaggctgccgagggcaccgacaccaaggccatctcgcgcgatcacgtc
atccgcatctcggaaagcggactgctgaccctgactggcggcaaatggaccacctaccgc
cgcatgggcgaggacgccgtgaaccgcgccgccgacctcgccgacctccccgcccgcctg
accctgacgccggggctgcacctgcacggctggagcgaagccgagcgcgaggaccactgg
aaggtctacggcagcgacgcgccgaagattcaggcgctggaaggtgccggcacgcggctg
cacccacggcttccctacagcgaggccgaggtgcgctgggccgtccggatggagcaggcc
cgcaccgtcgaggacgtgctctcgcggcgtttgcgggcgctgttgctgggcgcccaggcc
agcatcgaggccgcgccccgggtggcgcagctgctggccgaggaactcggcaaagacgct
gcctggcaagccgagcaggtgcaaggctaccgcgacctcgccgcagggtacctgctgccg
ggctga

DBGET integrated database retrieval system