KEGG   Cavenderia fasciculata (cellular slime mold): DFA_00822Help
Entry
DFA_00822         CDS       T02668                                 

Gene name
alp
Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00730  Thiamine metabolism
dfa00790  Folate biosynthesis
dfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DFA_00822 (alp)
   00790 Folate biosynthesis
    DFA_00822 (alp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dfa04147]
    DFA_00822 (alp)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dfa00537]
    DFA_00822 (alp)
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DFA_00822 (alp)
Exosome [BR:dfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DFA_00822 (alp)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dfa00537]
 Enzymes
  DFA_00822 (alp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme PalH
Motif
Other DBs
NCBI-GeneID: 14874041
NCBI-ProteinID: XP_004358803
UniProt: F4PU27
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MNPIDDSNNNNNNIKKEEPQLKNDIELYRINTHDDINESFYNSQKKEGRFSGRSKRVFYL
LAAIAVIVTVVLLIVFLIPRDKDILQPKRNIILLIGDGFGPASATMARIAKNGKTGVLNM
DSHLVGTLKTFSSSSDVTDSAAGATAYAAGVHTYNGAISVDPDTQKPVGAIIDATTTQGL
RSGLVVTTRLSDATPACFYAHSSQRQYEEFIISQVMNSDISVLMGGGLSKWSNATLDTAK
SRNYTIASTRDEMWASKNTSKILGLFAADNLPYEIDRVTFGMTHIPTLAEMTTKALQILS
EDNDSGFFLMVEGSQIDIAGHSNDAATQIRETLALDAAFQVVLEYAKNDPNTIVLMTADH
ETGGLTLGYQPVDSYAGEALYQWDPYTLMSINASSQTMAGFIQGNITAAGPTADIATIIR
TTVGHYTPSGNVTITDADIAFLAPLANTTSMWVFGRALGRVISSKANVGFTTTGHTGVDV
NLYAFHANDQDLIEELRGNHENIYLGQFIASNLKLDLAAQTTRLANFSTTPSPQQQK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaattgatgatagtaataataataataataatattaaaaaagaagaaccacaa
ttaaaaaatgatatagaattgtataggatcaatacacatgatgatattaacgaatcattc
tacaatagtcagaaaaaagaaggaagattctctgggagaagcaaaagagtgttttatctc
ttggctgctattgccgtcattgtcactgtagtattactcattgtatttttaataccaaga
gataaagatatacttcaaccaaaaagaaatattatcttattaattggtgatggttttgga
ccagcaagtgcaacgatggcacgtatagcaaagaatggaaagactggggtacttaatatg
gatagtcatttggttggaacattaaagacattttcatcgtcgagtgatgtgactgattct
gcggctggtgcaacagcctatgcggcaggagtacatacttataatggtgctattagtgtt
gatccggatacacagaaaccagtgggtgctatcattgatgcgactactacacagggtctt
agatcgggtctggtggtgacgacaagactgtcagatgcaacacctgcctgtttctatgca
cattcatcacaaagacaatacgaagagtttatcatatcacaggttatgaacagcgatatt
agtgtgttgatgggtggaggattgtcaaaatggagtaatgcaacgttggatactgccaaa
tcgcgaaactataccattgcatcgactcgtgatgaaatgtgggcctctaaaaacacgtcc
aagattttggggttgtttgcagctgacaacctgccctatgaaatcgatcgtgtcacgttt
ggcatgacacatatcccaacacttgcagaaatgacgaccaaagcactacagatcctctcc
gaggacaatgacagcggcttctttttgatggttgaggggtcgcagattgatattgccgga
cacagcaacgacgcggccacacaaatcagagagacgctggctctggacgctgcattccag
gtggttctcgagtatgccaagaacgacccaaacacaatcgtcttgatgactgctgaccac
gagacgggcggtctgacactgggctaccagccagttgactcgtatgccggcgaggcactc
taccaatgggacccatacactttgatgagcatcaatgcatcatctcaaaccatggccggc
tttattcaaggcaacattaccgctgccggaccgactgccgatattgcaaccatcatccgt
accaccgtcggtcactatacaccaagtggcaatgttaccattactgatgctgacattgcc
tttctcgcaccactagccaacaccaccagcatgtgggtgtttggtcgtgcccttggccgt
gtcatttcctctaaagccaatgttggctttaccaccactggtcacactggtgtcgatgtc
aatctctacgcctttcacgccaacgatcaagacttgatcgaagagttgcgcggaaaccat
gaaaatatttatcttggtcaatttatagcatccaatcttaaacttgatcttgctgctcaa
acaactcgacttgcaaacttttcaactactccttctcctcaacaacagaaataa

DBGET integrated database retrieval system