KEGG   Cavenderia fasciculata (cellular slime mold): DFA_00949Help
Entry
DFA_00949         CDS       T02668                                 

Gene name
suvA
Definition
(RefSeq) SET domain-containing protein
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    DFA_00949 (suvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dfa03036]
    DFA_00949 (suvA)
Enzymes [BR:dfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DFA_00949 (suvA)
Chromosome and associated proteins [BR:dfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     DFA_00949 (suvA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 14872882
NCBI-ProteinID: XP_004358924
UniProt: F4PUQ5
LinkDB All DBs
Position
Unknown
AA seq 1116 aa AA seqDB search
MSALSKGKSLNKQNYNQWFRTIPKVKVKETSVIPTKVRSISSSSSGSRSGSSSSGGSHHS
SSSSSSSSSSSLKNNNNNNNNNNNNNNNNNKTSTTSTTSTTSTTSTTSTKSRLEDATKEY
QRETYRVNNLTNEEREKELDRFLSLPPKKPPTSRQSSEPPSYDSLQKHLQSVDMDSLMDE
LDKMYKEALNKKVAKFYTDLTKKQQQQSQSQSQSSLSSSSSSPPLQNNNNNKSLPTIQKS
TTDQSSKVQKPELVKVSSEFTFSRIKVLSEDELLKINIDELEKKKSVAIQRLTQEIMDAD
MVIEKRKGLELKTKRKLEKDRLPQEKENEKEKEKEKVVSQSLPEKKVVPQTPLDEKTTSL
GPSPLLIPRQVLVQQQKEKEKEKEKEKEDVIDMDVSADVEENPKKRKAGNEKKTARKKTI
KKSIPIPVEDEKPLSFSAPSSSSSPALSFEDQPPPITSTTTNTNNNPIPINIDEKPNIVY
ISQNDREISLKMIENHFVQTVESTRVSPESIKEACAQLERKAFQESSCQKEYIEHLSTLY
EQLRKSLLQSLGQDPSQVSSTETTNQPTNQPNAIDPTTNTNTTNDQPIPPPPPLPPQAQP
PLPPPPPSLSNEQKDGIDSILSNLKHQTENMVMLDNETIKSVPINKTMKKPTSLVTQFTF
VVDSVKSKSLVTELRKDYDDSSWVAIRRERLISNTPATVTNKRIFKKYYDMIKDPKELDY
FLFLSLSFITGCSFDNVYNEFWILHNKKPLPFSLEELQETLAFTGDMKKSKLLTIRNHVS
KLITNKLNGITFKRSDDSDSDSDSDSDDDDEQNENSKSKSKSKKPVLWRDEDVARGKLSF
PLCATNSFDINGLILDGFTWIDKSFHHESVNTMINNNITDFSAPCQCIGDCHSPENRQKC
KCLSDSQAGAYYDEHGQLMMDYYINNKSIYECTDLCKCTGCKNKVVQDSNRYVLELFKTK
KKGWGVRSTSDIPANTFVCEYVGEIVSNSEAEIRGQKYDKKKASYLFDLDVPTMDGEEYF
CIDGTCYGNESRFLNHSCNPNLENFMVHDTADYRLPRIAFFSKRCIPKGEELTFNYGYEI
PHASGSKSAKRRGTSDVDIPCHCKAPNCRQWLWRVE
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactctcaaagggaaagtcattgaataaacaaaactacaaccaatggtttcgt
acgataccaaaagtaaaagtaaaggaaacctcggtgataccaacaaaagtaagaagtatt
agtagtagtagtagtggtagtagaagtggaagtagtagtagtggtggtagtcatcattca
tcctcatcttcttcttcatcttcatcatcttctttaaagaataataataataataataat
aataataataataataataataataataataaaacatctacgacatctacaacatctact
acatcaacaacatctactacatcgaccaaatcaagattagaagatgctacaaaagagtat
caaagagagacgtatcgtgtcaacaatttgaccaatgaagaaagagaaaaagagttggat
aggtttctaagtcttccaccaaagaaacctcctacctctagacaatcgtcagagccacca
agttatgatagtctacaaaaacatttacaatctgtagatatggatagtttaatggatgaa
ctagataaaatgtacaaagaagcattaaacaaaaaggttgccaaattctatacagatttg
actaaaaaacaacaacaacaatcacaatcacaatcacaatcatctttatcttcctcttcc
tcttctcctcctcttcaaaataataataataacaaatctttaccaacaatacaaaaatca
acaacagatcaatcatcaaaagttcaaaaaccagaattggttaaagtatcaagtgaattt
acattctctcgtataaaggtattatcagaggatgaattactaaagattaatattgatgaa
ttggaaaagaagaaatcggttgccattcaacgtttgacacaagaaattatggatgccgat
atggtcattgaaaaaagaaagggtttggaactaaagactaaaagaaaattggaaaaggat
cgattaccacaagaaaaggaaaatgaaaaggaaaaggaaaaggaaaaggtagtgtcacaa
tctctaccggaaaagaaggtagtgccacaaacacctctagatgaaaagactacatcacta
ggaccatctccattattaataccaagacaagttttggtacaacaacaaaaggaaaaggaa
aaagaaaaagaaaaagaaaaggaagatgttattgatatggatgtttcagcagatgtagaa
gaaaatccaaagaaaagaaaagctggaaatgaaaagaaaacggcaagaaagaaaacaatc
aaaaaatcaataccaatcccagtcgaagatgaaaaacctctttctttttcagctccatca
tcatcttcttctcctgctttgtcttttgaagatcaaccaccaccaattaccagtaccacc
accaataccaataataatccaataccgattaatattgatgaaaaaccaaatatagtgtat
atttctcaaaatgatagagaaatttcactaaagatgattgaaaatcactttgttcaaact
gtagaatctacacgcgtatcacccgaaagtatcaaagaagcatgtgcacaattggagaga
aaggcattccaagaatcatcttgtcaaaaagagtatattgagcatttatcaacactctat
gaacaactaaggaaatctctactccaaagtttgggtcaagatccttctcaagtatcatca
acagaaacaacaaatcaaccaacaaatcaaccaaatgcaattgaccctactaccaataca
aatacaacaaatgatcaacctattcctcctcctcctcctcttccaccacaagcacaacca
ccacttcctcctcctcctccatctctttcaaatgaacaaaaagatggaattgatagtata
ttatcaaatttaaaacatcaaactgaaaatatggtaatgttggacaatgaaacaatcaaa
tcagttccaatcaacaagacgatgaagaaaccaaccagtttggtgacacaatttacattt
gttgtagattctgtcaaatcaaagtcattggttacagagttacgcaaagattatgacgat
tcttcatgggtagcgattcgaagggaacgattgatttcaaatacaccggcgacagtaacc
aacaagagaatattcaaaaaatactatgacatgatcaaggacccaaaagaattggattac
tttttgttcctttcactttcatttatcactggttgttcattcgacaatgtatataatgaa
ttttggattctccacaacaagaaaccattgccattttctctggaagagctccaagaaact
ttggcatttacaggtgacatgaagaaatccaaactgcttaccattcgaaatcatgtttca
aaactcattacaaacaaattaaatggtattacttttaaaagaagtgatgatagtgatagt
gacagtgacagtgactctgatgatgacgatgaacaaaatgaaaattcaaaatcaaaatca
aaatcaaaaaaacctgttctttggagagatgaagatgttgcaagaggaaaattatctttt
cctctttgtgctacaaattcttttgatattaatggtttaattttagatggatttacatgg
attgataaaagttttcatcatgaatctgtaaatacaatgattaataataatattacagat
ttttctgcaccttgtcaatgtattggagattgtcatagcccagagaatagacaaaaatgt
aaatgtcttagtgactctcaagcaggtgcctattacgatgaacatggtcagttgatgatg
gattattatataaacaacaaatccatttatgaatgtacagatttgtgtaaatgcactgga
tgtaaaaacaaggtcgttcaagacagcaatcgttatgttttggaactattcaaaacaaag
aaaaagggttggggtgttcgttcaacatctgacattcctgcaaatacctttgtttgcgaa
tatgttggtgaaattgtctcaaattcagaagctgaaattcgtggtcaaaagtatgacaag
aaaaaggcttcttatttatttgatcttgatgttccaactatggatggtgaagaatatttt
tgtattgatggaacttgttatggtaatgaatctagatttttaaatcattcttgtaatcca
aaccttgaaaactttatggttcatgatacagcagattatagattaccaaggattgcattt
tttagtaaaagatgcatacccaaaggtgaagagttgacatttaattatggctatgagatt
cctcatgcttcgggatctaaaagtgctaaaagaagaggtaccagtgatgttgatatccct
tgccattgcaaagccccgaattgtcgtcaatggttatggcgtgttgaataa

DBGET integrated database retrieval system