KEGG   Cavenderia fasciculata (cellular slime mold): DFA_01310
Entry
DFA_01310         CDS       T02668                                 

Definition
(RefSeq) hypothetical protein
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
SSDB
Motif
Pfam: p450 DUF1374
Other DBs
NCBI-GeneID: 14872730
NCBI-ProteinID: XP_004359276
UniProt: F4PS43
LinkDB
Position
Unknown
AA seq 955 aa
MLFYIVLLPALYLIFSFINKNRGLSTKDPKRPWAVPVLGSLHVLGDKPHRSLDTLADTLG
CDMYALWMGDAYSIVCRDVESIREIWVKRHDIVVNRYHTPTSAVYSNNYTNIVSGDLERW
TFNRGMVSPSFTKLKVKTHHAKVVQNQCTQLLNHMKTFEKSNTLFKPRLYFKKFTMNIIT
RIAFGFDSPFEKDSEEFKEIIKKMDSIFLNGGTGTLGDFIHFLRPLFFFQMKLGGTAMSD
LRSLIKKIYDEHITNLDEKEPKDLMDEMIIQSTGMDNECGILSVGCDLLLAGTDTTAASL
EWFALRMITNPEVQDKVYQELVSVVGHGNRVDVSHRNSTPFTLSVIKEVLRLNPIAPLAL
SRASSEDMIIQDQFIPKGTQFLMNIHGLHRNKKIYQNPNQFIPERFLVDVPADAWIPFGI
GQRNCVGLNLALDELYVSISNMLLNFKFRAPDNVEIDFSEITDRSLVYFFPSLSIYLKMS
TIIYILIAVVIYLLVSFKNKNTKFSSADPPGPVSWPILGALPLLGDLPHQGFKRLADKFG
GVYSLWMGDTYTVVVTDPKVIREVWINNHENFLNRHHSPTYALYSSNYTNIVSGEDERWV
YQRGLVSPTFTKLKIKAVNSIVHSQVDGLLGQMKLYAKSQQLFNPRMYFKKYSMNIITKL
AFGMETPFDSETPEFVELNSRIDKLLVGTGAGHLGDYIYALRPLYFFKIFFVGNIMTGLR
SHISQIYHKHVKNLDEKNPKDLYDEILINTKGVDNELGLVSIGIDLLVAGTDTSSLTLEW
LVLRLLQNQHVQEKIYQELLDAVGKGGRADISHRSSTPYTVATIKEVLRMNPIVPLALNR
TSKEAVTCGGYYIPKGTQMVMNVYSVHLDEKLYPNPHVFMPERFLGETPADSWLPFGIGP
RNCVGLNLAQDELYLAVSNMLLNFKFRPATEKIDFTENFGLTMKPNPFSFYVDSR
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgttattttatattgtacttttaccagctttatatttaatcttttcttttattaataag
aatagaggattatcaacaaaagatccaaaaagaccatgggctgtaccagtattgggttca
ttacatgtattgggtgataaaccacatcgatcacttgataccttggcagatacattggga
tgtgatatgtatgcgttgtggatgggtgatgcctacagtatagtttgtagagatgttgaa
tcaattagagaaatttgggtaaagagacatgacattgtcgtcaatagatatcatacccca
acatcggccgtctattcaaacaactatacaaacattgtatctggtgatttggaaagatgg
acattcaatagaggcatggtatcaccatcatttaccaaactaaaggttaaaacccatcat
gccaaagtcgttcaaaatcaatgtactcaattattaaatcacatgaaaacttttgaaaaa
tcaaatactttgtttaaaccaagattatattttaagaaatttacaatgaatattattaca
agaattgcatttggatttgattcaccatttgaaaaggacagtgaagaatttaaagaaata
attaaaaagatggacagtatctttcttaatggtggtactggtacattgggtgattttatt
catttcctaagacctctattctttttccaaatgaaacttggaggaactgcaatgagtgat
cttagatcactaattaaaaaaatttatgatgaacatattactaatcttgatgagaaagaa
ccaaaagatttaatggatgaaatgattattcaatcaacaggtatggataatgaatgtgga
attcttagtgttggatgtgatttgttgttggctggaacagatacaacagcagcttcatta
gagtggtttgctttgagaatgattaccaatccagaggttcaagacaaggtataccaagaa
ttggtatctgtcgttggacatggaaaccgtgtcgatgtatcccaccgaaactcgacccca
ttcacattgtctgttatcaaggaagtactcagactcaacccaatcgcccctcttgcattg
tcaagagcatcatcagaggatatgattattcaagatcaatttattccaaagggtacccaa
tttttaatgaatattcatggactacatagaaacaaaaagatctatcaaaatccaaatcaa
tttattccagaaagatttttagttgatgtccctgcagatgcttggattccatttggtatt
ggtcaaagaaattgtgttggtttaaacttggcacttgacgaattatatgtttcaatttcc
aatatgttactcaattttaagtttagagctcctgataatgttgaaattgatttttctgaa
attacagatagaagtttagtttatttctttccctctctctcaatctatctcaaaatgtca
actataatttacatcttgattgcagttgtaatctatttacttgtttcttttaaaaataag
aatacaaagttctcatcagctgatcctcctggaccagtttcatggccaatattgggagcc
cttcctttgttgggagaccttccacaccaagggttcaagcgtttggcagacaagtttgga
ggcgtctattctctttggatgggtgatacctacactgtagtagtcactgatccaaaggtg
attcgtgaagtttggattaataatcatgaaaactttttaaatcgtcatcattcgcctact
tatgccttgtactctagtaactacaccaatattgttagtggtgaagacgagagatgggta
taccagagaggattagtatctccaacttttaccaaactcaagattaaagctgtcaatagt
attgttcattctcaagtagatggactattgggacaaatgaaactttatgcaaagtctcaa
caattgtttaatccaagaatgtattttaagaaatattcaatgaatattattacaaaattg
gcttttggaatggaaacaccatttgatagtgaaacacctgaatttgttgaattaaacagt
agaattgataaactccttgttggaactggagctggtcatcttggagattatatctatgct
cttcgtccattatactttttcaagattttctttgtaggaaatatcatgacaggtttaaga
tctcatatttcacaaatttatcataaacatgtaaagaatttagatgagaaaaatccaaag
gatttatatgatgaaattcttattaatacaaagggagttgataatgaattgggattggtt
agtattggtattgatttgttggtcgcaggaacagatactagttctttaaccttggaatgg
ctcgttttacgtcttcttcaaaaccaacatgtacaagaaaagatttatcaagaattgttg
gatgctgttggaaagggtggtcgtgccgacatttctcatcgtagtagcactccatacact
gtcgccactatcaaggaagtactcagaatgaatccaatcgttccattggcattgaacaga
acatccaaagaagctgtcacttgtggtggttattatattccaaagggtactcaaatggtt
atgaatgtatatagtgtacatttggatgaaaaattatatccaaatccacatgtatttatg
ccagagagatttttgggagagacaccagctgacagttggcttccatttggcatcggacca
agaaattgtgtaggtttaaaccttgcccaagatgaattgtatttggctgtttccaacatg
ctcctcaacttcaagtttagacctgcaactgaaaagattgatttcactgaaaactttggt
ctcactatgaagcctaatccatttagtttctatgtagactctagataa

DBGET integrated database retrieval system