KEGG   Cavenderia fasciculata (cellular slime mold): DFA_01593Help
Entry
DFA_01593         CDS       T02668                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00020  Citrate cycle (TCA cycle)
dfa00190  Oxidative phosphorylation
dfa01100  Metabolic pathways
dfa01110  Biosynthesis of secondary metabolites
dfa01130  Biosynthesis of antibiotics
dfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DFA_01593 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DFA_01593 (sdhA)
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DFA_01593 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 Dor1 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 14872567
NCBI-ProteinID: XP_004359557
UniProt: F4PTN7
LinkDB All DBs
Position
Unknown
AA seq 671 aa AA seqDB search
MNFFEFFANMFVDHQQLTADFVIIFEMLSISKNIVKSSLKLSNGVRSFHSSAQLMVNQSR
TGFEKGESQGQFSRAYPVIDHTYDAIVVGAGGAGLRAALGLTEKGLKTACISKLFPTRSH
TVAAQGGINAALANADVDDWRWHAYDTVKGSDWLGDQDAIHYMCREAVPTVLELEQYGVP
FSRMDDGRIYQRAFGGQSKNFGKGGQATRCCAAADRTGHALLHTLYGQSLKHDTKFFIEY
FVTDLIMENGECRGVIAYCMEDGTIHRFRSHATVLATGGYGRAYFSATSAHTCTGDGNAM
VTRAGLPCQDLEFVQFHPTGIYGSGCLITEGARGEGGYLLNSEGERFMPRYAPSVADLAS
RDVVSRSITMEILAGRGVGPEKDHALLNLTHLSPDIIEERLPGIRETAMIFAGVDITKEP
IPILPTVHYNMGGVPTNYKGEVVTRQPGEKTDTVVKGLYAAGEAACVSVHGANRLGANSL
LDIVVFGRACANTIADTLAKDTPHRPLPANAGEESIANLDKVRFADGTRSTAELRLEMQK
VMQRHAAVFRDGPILKEGVTNIDKFAQSLKTDLKTTDRNMIWNSDLVESLELQNLMTQAV
LTMHSAEARKESRGAHAREDFTERDDVNWMKHTLSYLDVETGKVTLDYRPVIGHTLDEAE
MHSIPPAKRVY
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttttgaattttttgccaacatgtttgttgatcatcagcaactcactgcagac
tttgttattatatttgagatgttatcaattagcaagaatattgtaaaatcaagcttgaaa
ttgagcaatggtgtaagatcattccacagcagtgctcaattgatggtaaatcaatcacgt
actggatttgaaaagggagagtcacaaggacagttttcacgtgcctacccagtcatcgat
cacacttatgacgccatcgttgttggtgctggtggtgctggtttgcgtgcagctctcggt
ctcacagaaaagggactcaagacagcttgtatcagcaagttgttccccacacgttcacat
accgttgccgcacaaggtggcattaacgctgcgttggccaatgccgacgtggacgattgg
agatggcacgcatacgacactgtcaagggcagtgattggttgggcgatcaagacgccatc
cactatatgtgtcgtgaggctgtgcccaccgtgctcgagctcgagcagtatggtgtaccc
ttttcgcgtatggatgatggccgtatctaccaacgtgcgtttggtggacagtccaagaac
tttggcaagggtggtcaggccacacgttgctgtgctgctgccgatcgtaccggtcacgca
ctcttgcacactctctacggacagtcgctcaaacacgacactaaattctttatcgagtac
tttgtcaccgatctcatcatggagaatggcgagtgtcgtggtgtcattgcctactgcatg
gaggacggaaccatccatcgtttccgttcgcacgccaccgtgctcgctaccggcggttac
ggacgtgcctacttttcggccacatccgcacacacctgcaccggtgacggtaacgccatg
gtcactcgtgccggtctcccatgccaagatctcgagtttgtgcagttccatccaaccggt
atctacggctcgggctgtctcatcaccgaaggtgcccgtggtgagggtggttacctcctc
aactctgagggtgagcgtttcatgcccagatacgccccatccgtcgccgatcttgcctcg
cgtgacgtcgtgtcgcgttccatcaccatggagattctcgccggccgtggtgttggccca
gaaaaggaccacgccctcctcaacttgacccatctctcaccagacattatcgaagagcgt
ctcccaggtatccgtgagaccgccatgatctttgccggcgtcgacatcaccaaggagcca
atccccatcttgccaaccgtccattacaacatgggtggtgtaccaaccaactacaagggt
gaggttgtcacccgtcaaccaggcgaaaagaccgacaccgtcgtcaagggtctctacgca
gccggtgaagctgcctgcgtgtctgtgcacggtgccaaccgtctcggtgccaactcgttg
ctcgatattgtcgtctttggtcgtgcctgcgccaacaccatcgccgacacactcgccaag
gacaccccacaccgtccactccccgccaacgccggtgaagagtcgattgccaacctcgac
aaggtccgtttcgccgacggcacccgttccaccgccgagctccgtctcgagatgcaaaag
gtcatgcaacgtcatgccgccgtctttagagatggacctatcctcaaggagggtgtcacc
aacattgacaagtttgcccaatccctcaagaccgacctcaagaccaccgatcgtaacatg
atctggaactctgacttggtcgagtcactcgaactccaaaacctcatgactcaagccgta
ttgaccatgcattcagccgaagcccgtaaggaatctcgtggtgctcacgctcgtgaagat
ttcaccgaaagagacgacgtcaactggatgaagcacacactatcatatttggatgttgaa
actggaaaggtcactttggattaccgtccagtcattggtcacactttggatgaagctgaa
atgcactctataccaccagccaagcgtgtctactaa

DBGET integrated database retrieval system