KEGG   Cavenderia fasciculata (cellular slime mold): DFA_01658Help
Entry
DFA_01658         CDS       T02668                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00010  Glycolysis / Gluconeogenesis
dfa00030  Pentose phosphate pathway
dfa00051  Fructose and mannose metabolism
dfa00052  Galactose metabolism
dfa01100  Metabolic pathways
dfa01110  Biosynthesis of secondary metabolites
dfa01130  Biosynthesis of antibiotics
dfa01200  Carbon metabolism
dfa01230  Biosynthesis of amino acids
dfa03018  RNA degradation
Module
dfa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DFA_01658 (pfkA)
   00030 Pentose phosphate pathway
    DFA_01658 (pfkA)
   00051 Fructose and mannose metabolism
    DFA_01658 (pfkA)
   00052 Galactose metabolism
    DFA_01658 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DFA_01658 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dfa01009]
    DFA_01658 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dfa03019]
    DFA_01658 (pfkA)
Enzymes [BR:dfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DFA_01658 (pfkA)
Protein phosphatases and associated proteins [BR:dfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DFA_01658 (pfkA)
Messenger RNA biogenesis [BR:dfa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DFA_01658 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 14873318
NCBI-ProteinID: XP_004359622
UniProt: F4PU04
LinkDB All DBs
Position
Unknown
AA seq 785 aa AA seqDB search
MEEEEKIVDFTYDKSSEKKRIAILTSGGDSCGMNPAIRAFTRAALIKGAQVFAVREGYNG
LVTDSIIPLHWGSVAGIINRGGTIIGTARSVEFRTREGRKKAAFNLIKNKINNLLVIGGD
GSLTGANLLRCEWASLLKELVEDKAIDEETFKTHETLGIVGLVGSIDNDMCGTEITIGAD
TACHRILEAIDAILSTAVSHQRSFVIEVMGRNCGWLALVSGLTTGADYILLPECPPEEGW
ENAMVESLEKGRLSGRRCSLVIVAEGSIDSNGKPISPGYVRDVLEKKAGHDARITILGHV
QRGGIPSFCDRYVSTRMAVEAVNYLYNGNILEPVLIGMHGNRVVRAPLMEAVKETQAIGA
LIREKKFADVVKLRGGIFQEAHTIFNICANLKRSPVAKKGFNVAILHSGGPSPGMNPAVR
AFTRLGIDLGYRVFGVFNGFSGLAKGDLQELTWMTCNGWSVMGGAELGTNRSTPNESNIA
AIIKTLQDNNIGAICMFGGYNGYVGITELAKFRAKYSYLQKVALVCAPGTIANNVPGTET
SIGADTCLNNILDALDKIKQSAVASRRLFVVEVMGAHCGYLCSMAALTSGAERAYTMEEG
ITINTLVDDLNMFVDRFKREHKIGLIIKSESASETYSTKFIYELFKEEGKHLFDVRESIL
GHLQQGGIPSPLDRLNASRLMYHFFQLLQTEVIDNRQTDLSGCIGFIKGKIVFTPLQEMS
EGINHKYRRPQKQWWLDLLKLSSQISVSRGEAKINDNLRTPIHSPTIHSKPSLETDSLLN
PLKTL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaagaaaagattgtagattttacatatgacaagagcagtgaaaagaagaga
atagctattctcacatcaggtggtgatagttgtggtatgaatcctgctattcgtgccttt
actagagctgctctcattaaaggtgctcaagtatttgctgttcgtgaaggttacaatggt
ttggtaactgattctatcattccattacattggggttctgttgctggtattattaataga
ggaggaactattattggtacagcaagaagtgtagaatttagaacaagagaaggtagaaag
aaagcagcatttaatttgatcaagaacaagattaataatctattggtgattggaggtgat
ggtagtttgacaggtgccaatctacttcgatgtgaatgggctagtcttttgaaagagttg
gttgaagacaaggcaatcgatgaggagaccttcaagacacatgaaacacttggcatcgtt
ggtttggttggttctatcgacaatgatatgtgtggtactgaaatcacaatcggtgctgat
actgcttgtcacagaatcttggaagctatcgatgctatcctcagtacagctgttagtcat
caaagaagttttgtcattgaagttatgggtagaaattgtggttggttagcattagttagt
ggattaacaactggtgcagattatattcttttaccagaatgtccaccagaggaaggatgg
gagaatgcaatggtggagagtttggaaaagggtagattgtcgggaagaagatgtagtttg
gtgattgtcgccgaaggatccatcgatagcaatggaaagccaatctcaccgggttatgtt
agagatgtactcgagaaaaaggctggtcatgatgctagaatcaccattcttggacatgtg
cagagaggtggtatcccatcgttttgcgatcgttatgtatcgactagaatggctgttgaa
gcagtcaattatctctacaatggtaatatattggaacccgtgttgattggtatgcacggt
aaccgtgtggtgcgtgctcccttgatggaggcagtcaaggagacacaggcaatcggcgca
ttgatcagagaaaagaagtttgccgatgttgtcaagctcagaggtggtatctttcaagag
gcacacactatattcaacatttgtgccaatttgaaacgatcaccagtcgccaagaagggg
ttcaacgttgcgatcctccatagcggtggaccatcgccgggtatgaatccagcagtccgt
gcgtttacaagacttggtatcgatctagggtaccgtgtgtttggtgtgtttaacgggttc
tcgggtctggccaagggtgacttgcaagagttgacatggatgacttgtaatgggtggtcg
gtgatgggtggtgccgagctgggcaccaaccgttcgacccctaacgaatccaatattgcc
gcgatcatcaagacattgcaagacaacaatattggcgccatctgcatgtttggtgggtac
aatggttatgttggtatcaccgagttggccaagttccgtgccaaatactcgtacttgcaa
aaggtggcgttggtgtgcgcaccaggtaccattgccaacaacgtgccaggcacggaaaca
tcgattggtgccgacacatgtctcaacaacatcttggacgcactcgacaagatcaagcag
tcggctgtcgccagtcgccgtctgtttgtagtcgaggtgatgggtgcccactgcggttac
ctatgctcgatggctgcattgactagtggtgccgaacgtgcctataccatggaagagggt
atcaccatcaacacgctcgtagacgatctcaacatgtttgtcgaccgtttcaagcgtgaa
cacaagattggtctcatcatcaagagtgaaagtgcctctgaaacctactctaccaaattc
atctatgaactcttcaaagaagagggtaagcacctgtttgatgtacgtgagtctatcctc
ggccatcttcaacagggtggtatcccctcgccactcgaccgtctcaacgcgtctcgtctc
atgtaccatttcttccaactccttcaaaccgaggtcattgacaatcgccaaaccgatctt
tcaggatgcatcggctttatcaagggaaaaattgttttcactcctctccaagaaatgtct
gaaggcatcaaccacaagtatcgtcgtccacaaaagcaatggtggctcgatctcctcaaa
ctctcttctcaaatttcagtgtctcgcggtgaagccaaaatcaatgacaaccttagaact
ccaattcattcgccaaccatacattcaaaaccatctttggaaactgatagtttacttaat
cctttaaaaactttataa

DBGET integrated database retrieval system