KEGG   Cavenderia fasciculata (cellular slime mold): DFA_07212Help
Entry
DFA_07212         CDS       T02668                                 

Definition
(RefSeq) putative guanine nucleotide exchange factor
  KO
K20161  DENN domain-containing protein 2
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Brite
Membrane trafficking [BR:dfa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    DFA_07212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DENN LRR_8 DUF2340 uDENN dDENN LRR_4 SPA LRR_9
Motif
Other DBs
NCBI-GeneID: 14872495
NCBI-ProteinID: XP_004367078
UniProt: F4PVT1
LinkDB All DBs
Position
Unknown
AA seq 2085 aa AA seqDB search
MSSEEQQQQQSNNGLVTVRVVKSLEYRNIKNLVLRDIDLNMKVSEFKEYVKNNEDRLTDC
GVINETEISFFNLEDYNNFKANPKERKIEDESSINDVYKNGAGGIIPFVKDVYPPDQVDP
NVPLFCFPEEIDNKAFMNQTYTPSKSSESFSFVLTDREGNQQFGFTRRIVTAVPTLGRIP
ESLCIISKHAWFSTFIAILEILEVRYRASMEEIHNFLAAALLSAIPAPGDTFTVYIYNNP
FISASSSSSSSTSTTTSPSATTITGTRDRSLSTPNLTISTGGAGDPHHQSDKSSQPLPVS
YQLKRPLATDKSSLHDGTLLPLIESLTSQKILSLFISLLFERRIIIYSENISRVSKFVNA
AVSMIDPFVWQHIFIPILPRSLLDYVTAPMPFIIGIHSSLFPLIRKKPLSEIIYVDLDKD
HVLPLPEDIALFPPQLLQPLKVCLDLQIADFKKNKHYDNKVIVDTFRKFFVTIMGTYRRF
FLKDLDKRKSIFDKASFIDSQIINPAKFFTTFCSSQMFERFIAEREEYFFKGITPPGSFE
KEVILYDLKHPVTASINNTLKNKEKEKEKEREKERLEKERAKSVAKANAYKTVLDPKRLS
VLNPPKSNGLSVDRSFLSSLIGTNNNSSATVGSLTVVNTSTPSTSPSLPRAASPTMTRST
TMGSISSKAQTMTALEVGSLAPLTDVQLPIPAHIQQQQQQQKLQQQQQLLQQQQTSEQQG
GVSLPKPKSHTNLASLASNIVQNAASITKSTSASFTLGHGQSLLPPNPTLPSGNQSLSSA
THTGGSHSRTLSDVGNIILSVTKKSTQILSSGTTQPTKPIASDQTLNSNNVNTAATSNVI
PPTTTAAANTTTTNNTVQIIQTHPNSPTRMGIGHRSLPFTLIHQKFSPNDPTRMTIEDIF
NLFYPGQKPSNGTTTPVVTPHQPVTSTSGMKKSTSQEKNIFKIPELPDNISIPLSINKTN
KNQFMTQASGSAGNINTQHATNTNSGIQLTASAPANPTIISSSYAVSDKSTLPPPPISAH
SILHRRTHQRSVSEKELLEAEKEQLLLQQQQIQQVQQVQVQQQPMVVAAGGGGIQQPQPS
LRLSSSSVPKPITTSSQLEQQQQQQQHLQPIVENVLQQQQQQQEHNGLPPLTSTVQLPIP
VANVDHNPLPPLNTGAPVVVDLNTSGSSLIHRSGGTPMMCRTMSSNNFFDNNPLSTNIET
SPAVVLASSTASCSSSNSNFFNECSLLGVPSSLPHIAGSTPLSTATSSVAALSSTSSLNS
SYGSFTSAVLNNSNILSASGMMMMPPSAAMISAAAAAQQGQQQQHTQPQQQQQPQQPQQQ
QVSVPVSSTPVVPVSAAVASGGGVPSQQQQQQQQQQPNNNHSNASSFSSNQNVVTSSTSN
VLPPLIPHGGSTTSLLPPPASLHSNHFFDQSPLSQSSFVDFGPPAPSLPGLNNNSNGPYN
QMLASSTPPTYTQPQQVQPQQQPPVQQGENVSLEREMVKANIKECLKNEDTAIPLELDLN
SLKLNKFPSELKKEIYRDKKKLVKAMIKKLDVSINKLNDFKWDLSSSFDQLDYLNLSGNP
LSSLMTIGLPGSVYLKTITKIDVCGCKLLRVGQNDLRQLTNLAQLNLSNNEIGEIHPEAL
SCLAQLEDLNVSGNSSLKAIPEAVLKCRQITHLDVSGCSINELPHDLSPLAKMLELNLGN
NNISEIPDSISLLVFLCRINLQDNNIRNLPLSIGKCRGIVSQMNGIILHGNPLDAEIKQL
YNENPAKLAAYLERRYQLQGGDTLNFKLAAQYKHQQQQPAAATPTKSSPPLYPQSPPNTG
YPIATTTSTTTSSNQANSAASSLQSNTPTTSVLSTSNGSSMASSPRSYKLSVSNEAWREL
PNHIPGPKHNLGGGGSSASSSPISSSPMTNPLRLSQQYQQQQPPPSPLHHSAGGIRTQFQ
FSDSPSSSPSTPSPLSSSPQFMTQQQQQHPEDPTVTMMKENIYGMIKNEFRQNITSIYEK
VNKSSNVKELIQFATIVRSIQSELDDIGKILAYKKIYLPNIEKNIGSNASETEKFNQLKQ
LVKSKIEICVIYSKHTIEHVDIQHSMSDLSFVYRVIKSLSNKLTL
NT seq 6258 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgaagaacaacaacaacaacaaagcaacaatggattggtgacagtcagagtc
gtaaagtcactcgaatacagaaatatcaagaatctagtactacgtgacatcgatttgaat
atgaaggtttcagagtttaaagaatacgttaaaaataatgaagatagattaacagattgt
ggagtgatcaatgagacagagatatcattctttaatcttgaagattacaataattttaaa
gcaaatccaaaagaaagaaagattgaagacgagtcatctatcaatgatgtatataaaaat
ggagcaggaggaattataccatttgtaaaggatgtttatccaccagatcaagtcgatccc
aatgtaccattgttttgttttccagaggagattgataacaaggcgtttatgaatcaaacc
tatacaccttcgaaatcgagcgaatccttttcatttgtattgacagatagagagggaaac
caacagtttggattcacacgtcgtatagtgactgctgtccctacgctgggacgcatccca
gagtcactgtgtatcatatcaaaacatgcatggtttagtacatttatagcaatcttggag
atactcgaggtgagatatcgcgcatcaatggaggagattcacaactttttggcagctgcc
cttctctctgccattcctgcaccaggtgacacctttacagtctatatatacaacaaccca
tttatatctgcatcctcttcatcatcatcatctacatcgaccactacatcaccttcagca
accactatcacaggtacacgcgatcgtagtctgtcaacacctaatcttaccatttcaact
ggtggtgctggggatccccaccatcaatctgataagagttctcaaccattacctgtatca
tatcaattaaagagacctttggcaactgataaatcatcgttgcacgacggaacattatta
ccattgatagagtcattgacatcacaaaagattctatcattgtttatatctctgttgttt
gagcgacgtataatcatctactcggagaatatcagtcgcgtgagcaagtttgtcaatgcg
gccgtctcgatgatcgatccatttgtttggcaacatatattcatccccattcttcctcgt
tctctattagactatgtcacggcaccgatgccatttatcattggtatccattcatcactg
tttccattgattcgtaaaaagccactctctgaaatcatctatgtcgacttggacaaggat
cacgtccttcctctaccagaagatatagcattgtttcctcctcaacttttacaaccttta
aaagtttgtttagatttacaaattgctgattttaaaaaaaacaaacattatgataacaaa
gtaatagttgatacatttagaaagttttttgttactattatgggtacctatagaagattc
tttttaaaggatttagataaaagaaaatcaatttttgataaggcatcatttattgattct
caaattattaatcctgcaaagttttttacaacattttgttcatcacaaatgtttgaaaga
tttatagcagaacgtgaagaatattttttcaagggaattacaccaccaggatcatttgaa
aaagaggttattctttatgatttaaagcatccagtaactgcatcgatcaataatacattg
aaaaacaaggaaaaggaaaaagaaaaagagcgtgaaaaggagagattggaaaaggaacgt
gcaaaatccgttgccaaggcaaatgcttacaagacggtactcgatccaaagagattgagt
gttttaaatccaccaaaatcaaacggtcttagtgtagatcgttcattcttgtcatcactc
attggaaccaataataatagcagtgcgactgtgggatcactcacagttgtaaacacgagt
acaccatctacatcaccatcactaccacgtgctgcgtcacctacaatgacacggtctacc
acgatgggtagtatatcgtcaaaggcacaaaccatgactgctctagaggttggttcactt
gctcctctaaccgatgttcaattaccaatccctgctcatattcaacaacaacaacaacaa
cagaaattacaacaacaacaacaactattacaacaacaacaaacatcagaacaacaagga
ggagtatcattaccaaaaccaaaatcacataccaaccttgcttcattggcttcaaatatt
gtacaaaacgcagctagtattacaaagtcaacatcagcttcatttacattgggacatggt
caatcgttgttaccaccaaatccaactcttccctctggtaatcaatcgttgtcgtctgcc
actcacactggtggatctcatagcagaactctttcagatgttggaaatatcattctatct
gtaacaaagaaatctacccaaatattgtctagtggcactacacaaccaacaaaaccaata
gcatccgatcaaactctaaatagtaataatgttaatactgcagcaacaagcaatgttatc
ccacctactactactgctgctgctaatactactactaccaacaatactgtacaaattata
caaacacatccaaattctcctactcgtatgggtattggacaccgatctttaccatttaca
ttgattcatcaaaagttctcaccaaacgatccaactagaatgaccattgaagatatattt
aatttattctatccaggacagaaaccaagcaatggaacaacaacacctgtcgtcacccca
caccaaccagtgaccagcacaagtggtatgaaaaaatcaacgtcacaagaaaagaatata
ttcaagattccagagttgcccgataatatatccatccccttgtcaatcaacaagacaaat
aagaatcaatttatgacacaggctagtggaagtgcaggcaatatcaacacccagcacgct
acaaacaccaactctggcatccaattgacggccagtgcaccagccaatccaaccatcatt
tcatcatcctacgctgtttccgataaatccacccttccaccccctcccattagcgctcac
tctattcttcatcgaagaacacatcagagatctgtatctgaaaaggagttattggaagct
gaaaaggaacaattattattacaacaacaacaaattcaacaagttcaacaagtacaagtt
caacagcaacctatggttgtggctgcaggaggaggaggaatccaacaaccacaaccatca
ttaagattatcatcatcatctgtaccaaaaccaattactacgtcatcacaacttgaacaa
caacaacaacaacaacaacatttacaaccaatagtagaaaatgttttacaacaacaacaa
caacaacaagaacacaatggattaccacctttgacaagtactgtacaattaccaatacct
gtagccaatgtagatcataatccattaccaccattgaatactggtgcacctgtggttgta
gatttaaatacctctggatcatcattgattcatcgtagtggaggcaccccaatgatgtgt
cgtacgatgagtagcaacaactttttcgataataaccctctctcgaccaacattgagacg
tcaccagccgtagtgttggcatcgagtactgctagctgctcgagtagcaacagcaacttt
ttcaatgaatgttcattgttgggtgtgccatcttcgttgccacacattgcaggctcgaca
cccctttcaacagcaacatcatctgttgcagcactcagcagcacctcttcgttgaatagt
tcctatggatcatttacatcggcagtcttaaacaatagtaatatattatcggcatcgggt
atgatgatgatgccaccatcagctgcaatgatatcagcagctgctgctgctcaacaagga
caacaacaacaacatacacaaccacaacaacaacaacaaccacaacaaccacaacaacaa
caagtttctgttcctgtttcatctacaccagttgttccagtgtcagcagcagtagcatca
ggaggaggagtcccatctcaacaacaacaacaacaacaacaacaacaaccaaataacaac
catagtaatgcttcatctttttcatccaatcaaaatgttgttacttcttcaaccagcaat
gttttaccacctcttattccacatggaggtagtactacttctttgttgcctcctcccgcc
tcactccacagcaaccactttttcgatcaatcacctcttagccaatcatcgtttgttgat
tttggacctccagctccatccctccccggtctcaataataatagtaacggaccatataat
caaatgttggcatcatccactccaccaacctatactcaaccccaacaagtacaaccacaa
caacaaccaccggttcaacaaggagaaaatgtatctctagagagagaaatggttaaagca
aatataaaggaatgtctaaagaatgaagacacagcaattccattggaactggatttaaat
tcattgaaattgaataaatttccaagtgaattgaaaaaggaaatatatagagacaagaag
aaactggtcaaagcaatgataaagaaacttgatgtcagtatcaacaaactcaacgatttc
aaatgggacttgtcatctagttttgaccaattggactatctaaatttgtcggggaatcca
ttgtcatcgttgatgacgattgggttacctggatccgtctatctcaagactatcaccaag
attgatgtatgtggatgcaaattattacgtgttggacaaaacgatctcagacaattgacc
aatcttgctcaactcaatctctccaacaatgagattggcgagattcatccagaggcattg
agctgtcttgcccaactcgaggacctcaatgtcagtggtaactcgtctctcaaggccatt
ccagaggctgttttaaagtgccgtcaaatcactcatttggatgtcagcgggtgttcaatc
aatgaactgccacatgacctctctcccctcgccaaaatgctcgaactcaaccttggaaat
aataatatcagcgagattccagattcgatcagtctcctcgtttttctttgtcgcatcaat
ctccaagacaacaacatccgcaatcttccactgtcaattggaaaatgtagaggcattgta
tcccaaatgaacggtatcatccttcacggcaatccattggatgctgaaatcaaacaattg
tacaatgaaaatccagcaaagttggcagcctatctcgaaagaagatatcaactacaaggt
ggtgacacactaaactttaaattggcagctcaatataaacatcaacaacaacaaccagca
gcagcaacgccaacaaaatcatcaccacccttgtacccacaatctccaccaaatacagga
tacccaattgctactactacctctaccaccacttcttccaatcaagccaattcagcagct
tcatcactacaatcaaatactccaactacatcagtactatcaacgagtaatggtagttca
atggcttcatcacctcgatcctacaaattatcagtatcaaatgaagcatggagagaattg
ccaaatcacattcctggtccaaaacacaatcttggtggtggtggatcatctgcttcttct
tcccccatttcctcatctcccatgacaaatcctttaagactctcccaacaatatcaacaa
caacaaccaccaccatcaccactacaccatagtgctggtggtattagaactcaatttcaa
ttttccgactccccatcatcgtcaccctctactccatcacctttatcatcatcacctcaa
tttatgacgcaacaacaacaacaacatccagaagacccaaccgttacaatgatgaaagag
aatatttatggaatgattaaaaatgaatttagacaaaacattacatcaatctatgaaaaa
gtaaacaaatcatcaaatgtcaaagaactaattcaatttgctacaattgttagatctatc
caatctgaattggatgatattggaaagattctggcatataaaaagatttatttaccaaat
attgaaaaaaacattggaagtaatgctagtgaaaccgaaaaattcaatcaattgaaacaa
cttgttaaatcaaagattgaaatatgtgtaatttattcaaaacatacaatagaacatgtt
gatattcaacatagtatgtctgacctatcttttgtctatagagttattaaatcattatca
aataaattgactttataa

DBGET integrated database retrieval system